SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_476702.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_476702.1.81976
Domain Number 1 Region: 745-1035
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 1.19e-52
Family Rhodopsin-like 0.0011
Further Details:      
 
Domain Number 2 Region: 149-455
Classification Level Classification E-value
Superfamily L domain-like 1.56e-51
Family Ngr ectodomain-like 0.036
Further Details:      
 
Domain Number 3 Region: 367-619
Classification Level Classification E-value
Superfamily L domain-like 2.18e-41
Family Ngr ectodomain-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_476702.1.81976
Sequence length 1360
Comment rickets [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MAARCRWSWRLALCPLLLQLLLQLLLLPPSAMGHDETKENPAPDMQNSQEQEPYVHLQHL
QQQQQQNPQTVQQLSQITVNRTSKSASVTPTGIRENVMLPSADPEKEAQILYEKSLQEYH
GSQLSTASTATDVIAGKRTLHSICERWLQKHCHCTGSLEVLRLSCRGIGILAVPVNLPNE
VVVLDLGNNNLTKLEANSFFMAPNLEELTLSDNSIINMDPNAFYGLAKLKRLSLQNCGLK
SLPPQSFQGLAQLTSLQLNGNALVSLDGDCLGHLQKLRTLRLEGNLFYRIPTNALAGLRT
LEALNLGSNLLTIINDEDFPRMPNLIVLLLKRNQIMKISAGALKNLTALKVLELDDNLIS
SLPEGLSKLSQLQELSITSNRLRWINDTELPRSMQMLDMRANPLSTISPGAFRGMSKLRK
LILSDVRTLRSFPELEACHALEILKLDRAGIQEVPANLCRQTPRLKSLELKTNSLKRIPN
LSSCRDLRLLDLSSNQIEKIQGKPFNGLKQLNDLLLSYNRIKALPQDAFQGIPKLQLLDL
EGNEISYIHKEAFSGFTALEDLNLGNNIFPELPESGLRALLHLKTFNNPKLREFPPPDTF
PRIQTLILSYAYHCCAFLPLVAMSSQKKTSQVQEAVLFPSDAEFDMTLWNNSMMNIWPQM
HNLSKQLGASMHDPWETAINFNEEQLQTQTGGQIATSYMEEYFEEHDVSGPATGYGFGTG
LFSGMSTEDFQPGSVQCLPMPGPFLPCADLFDWWTLRCGVWVVFLLSLLGNGTVVFVLLC
SRSKMDVPRFLVCNLAAADFFMGIYLGILAIVDAATLGEFRMFAIPWQMSVLCQLSGFLA
VLSSELSVYTLAVITLERNYAITHAIHLNKRLSLKQAGYIMSVGWVFALIMALMPLVGVS
DYRKFAVCLPFETTTGPASLTYVISLMFINGCAFLTLMGCYLKMYWAIRGSQAWNTNDSR
IAKRMALLVFTDFLCWSPIAFFSITAIFGLQLISLEQAKIFTVFVLPLNSCCNPFLYAIM
TKQFKKDCVTLCKHFEESRVVGGGGPGGRGAVARTKRGDLPPPLLPAAAVAHPPGCRCLR
MLPSEMPNWHKMEQTPSMWQRLRTFCCGENRRRRKQRRQPQQRRQRAYTAAAANPYQYQF
AELRQQRQNRASSISSENFCSSRSSSWRHGPPSSAPVPPGNCSMPLKMLEPHAHPHGHGR
RRHSAWLITRKTSQDSNLSSSRNDSSASATTASTSTFRLSRSSAGSSTPLPSIIAHNGKA
QLDAVKPRLVRQEAVQEEEDSSPPRLGVRFLPTIPSAADSSVVMEDGDSANTGVASFLGM
PLPGASSGFLIAPTTAATTSPPPVVLQPAKPPPDPNDAPL
Download sequence
Identical sequences Q7KTA0
7227.FBpp0080184 FBpp0080183 FBpp0080183 NP_476702.1.81976 FBpp0080183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]