SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_492381.3.50509 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_492381.3.50509
Domain Number 1 Region: 378-562
Classification Level Classification E-value
Superfamily Fibronectin type III 1.01e-26
Family Fibronectin type III 0.0026
Further Details:      
 
Domain Number 2 Region: 3-34,106-190
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.06e-24
Family Voltage-gated potassium channels 0.0042
Further Details:      
 
Domain Number 3 Region: 214-297
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.59e-18
Family Voltage-gated potassium channels 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_492381.3.50509
Sequence length 608
Comment TWiK family of potassium channels [Caenorhabditis elegans]; AA=GCF_000002985.6; RF=reference genome; TAX=6239; STAX=6239; NAME=Caenorhabditis elegans; strain=Bristol N2; AL=Complete Genome; RT=Major
Sequence
MARFLSLHVLLIGSVVLYIILGAIVFQMLEGEHLDALKKDHMAKIEQNAKDYVDKLWSVA
KRDRDKYKNVEDLIKSVKEDTVDDFNDYVDTVFYAHRAVRHGYDEDSPTWDFANSVFFTT
TMLTSIGYGYVAPSTFGGRLFGVIYCLIGIPLTLVTVANVAKFLSETIFFLHYELWNKCL
EWKRKRKGEVEADPLQPMFGDDENEEEILDRVRLVRFPPLTVFFFVFVYGCIAAWVVRYW
ETWTYVESLYFIFISILTVGFGDIRPSPGNIWVTLAFVVVGVILTTMCMDVVGRMYLKEI
HYLGRKLKSSNPFYLLREAKARRRRAAMASLLAQLAKGMIFAHKDYNELARKKSKRKKEK
RRGSHVLPNEKFMFARLPPDPPSDCQVVSTSAYSVRLAWAPPFSPDPDLTYNIRYRLKHN
EDAKVRELRGIKGNTVEIMSVDSCSLYEFRITAHNKFGESKAVYLVQYTEPQLSPQHILA
TRLNANTIELTWEPPYKKSHEVKNYVVYFTENPNASLSEWEKIPVNGRRVVFPDLRFDWF
YMFSATAVFKDGQRSPLSRALFIKTDKIEFHKHCVGHSKTIDVMDSICEKEDNETTALLK
RDYVSFAV
Download sequence
Identical sequences P90863
6239.F36A2.4 F36A2.4 F36A2.4 NP_492381.3.50509 F36A2.4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]