SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_498333.1.50509 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  NP_498333.1.50509
Domain Number - Region: 176-223
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0374
Family Spectrin repeat 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_498333.1.50509
Sequence length 301
Comment Uncharacterized protein CELE_Y42G9A.1 [Caenorhabditis elegans]; AA=GCF_000002985.6; RF=reference genome; TAX=6239; STAX=6239; NAME=Caenorhabditis elegans; strain=Bristol N2; AL=Complete Genome; RT=Major
Sequence
MDDSQESSFSVSKYETNDDGSMGQFISINECEREIQMLERDIRQQKESSANAKTAITFDQ
LRKIHTLSTLLGPHKELFFDRICRAADIQRASLKNRLKSNINKFEPSTPLSFQPGFDSQS
SLSTTSESQNFVVTPTTLSSLLNNHTRKNHIEMLAPLASEEELMRFPAERQFDLMQIGFS
YDEVKQLLEMFEKFKNDVQEINRLHTLTQILNQFCNYISMYAPPNLKMISSAFNLLELGN
SAHEVKRVLLKARRREESEESDVSFSKKPRPSSRSPASPNRDDLLLGLDRSPPSDDGTQK
V
Download sequence
Identical sequences Q9N4Z2
Y42G9A.1 Y42G9A.1 Y42G9A.1 Y42G9A.1 NP_498333.1.50509 6239.Y42G9A.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]