SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_498633.1.50509 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_498633.1.50509
Domain Number 1 Region: 197-429
Classification Level Classification E-value
Superfamily PH domain-like 3.57e-75
Family SSRP1-like 0.00000626
Further Details:      
 
Domain Number 2 Region: 544-628
Classification Level Classification E-value
Superfamily HMG-box 1.07e-22
Family HMG-box 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_498633.1.50509
Sequence length 697
Comment FACT complex subunit SSRP1-A [Caenorhabditis elegans]; AA=GCF_000002985.6; RF=reference genome; TAX=6239; STAX=6239; NAME=Caenorhabditis elegans; strain=Bristol N2; AL=Complete Genome; RT=Major
Sequence
MAELQFPGVYVEDVGHLAFGTLKLTEKSLNFKGDKGGKSVNVTGSDIDKLKWQKLGNKPG
LRVGLNDGGAHRFGGFKDTDLEKIQSFTSSNWSQSIDQSNLFIKGWNYGQAEVKGKTVEF
SWEDKPIFEIPCTNVSNVIANKNEAVLEFHQNDDSKVQLMEMRFHMPIDLENEEDADKVE
EFKKAVLAYAGLEAETEQPICLLTDILCTTPRGRYDIKVYPTSIALHGKTYDYKIPIKSI
NRLFLVPHKDGRHVYFVLSLNPPIRQGQTRYSYLIFEFGKDEEQDLELALTDEQLESSNG
NLRRDMTGPIYETISILFKSICNLKITVPGRFLGSSGTPAIQCTHRQNPGLLYPMEKGFL
FIHKPAMYIRFEEISSCHFARSDSGTVTRTFDFEIDLKYGGPLTFNAMEKEENNKLFDYL
NKKNIKIRNSQRVENTVADSSDDEIDPYKAAVTAEGRQRDDSDDDSTDEDYDLDKDIKKK
KEDKESSEGTGSEPDDEYDSGSEQDSSGTGESEPDSEQDVPSKRRKGEPKEKREKKEKRE
KKEGKKGKKDKDPNAPKRATSAYMQWFLASRNELKEDGDSVADVAKKGGAKWKTMSSDDK
KKWEEKAEEDKSRYEKEMKEYRKNGPPSSSSKPSSSKTSKKSSGPSSSKAISKEYISDSD
DSDDEEPKKKEKKAAPKEESEESNNGSDGSDESDDSD
Download sequence
Identical sequences P41848
T20B12.8 T20B12.8 6239.T20B12.8 T20B12.8 NP_498633.1.50509 T20B12.8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]