SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_501426.3.50509 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_501426.3.50509
Domain Number 1 Region: 511-584
Classification Level Classification E-value
Superfamily GAS2 domain-like 2.62e-20
Family GAS2 domain 0.0006
Further Details:      
 
Domain Number 2 Region: 198-368
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000000000000103
Family Calponin-homology domain, CH-domain 0.00085
Further Details:      
 
Domain Number 3 Region: 13-182
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000000000364
Family Calponin-homology domain, CH-domain 0.00079
Further Details:      
 
Weak hits

Sequence:  NP_501426.3.50509
Domain Number - Region: 382-491
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0118
Family Spectrin repeat 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_501426.3.50509
Sequence length 727
Comment Uncharacterized protein CELE_D2096.11 [Caenorhabditis elegans]; AA=GCF_000002985.6; RF=reference genome; TAX=6239; STAX=6239; NAME=Caenorhabditis elegans; strain=Bristol N2; AL=Complete Genome; RT=Major
Sequence
MSKFAASGGKRLEEEIGKLQADADHIFEALAVISKDEALQESPSLLLVSKQVSKKIEQLK
VLLKLVEEKKDTFISKCKLVMRTAGPESDAKELDSLMKHVEDAYSDVFELISDKEGLIDR
FNASNINSDSVPNTESLNLAFAAADPEFGAGRLLDAEDVDTNNNPDEKPVITYVSSLNNA
PQDPEMSRLAASGGKGFEEEIGKLQADADHIFEALAVMSKDEALQESPSLLLYSKQIRFN
KIQKLKELLKPVEEKKDTFISECKLVMKTAGPEADTKELDSLLKQVEDAYSDVFELISDK
EGLIDRCNASNINSDSVSNTERLNIALAAADAEFGAGRLLDAEDVDTNNNPDEKSIITYV
SSLNNAFPLEPEMSKYVASGGKRLEEEIGKLQADADHIFKALEEISKDEALQESPSLLLD
SKQVSKKIEQLKVLLKPVEEKKDTFISESKLVMKTVGPESDAKELDSLMKHVEDAYSDVV
ELISDKEGLIDRCNASNRIAHPQTETEKITNEIELLKETCSCCTPYQIEKISENYYRFGD
THIKRMVRILRSTVMVRVGGGWEPLEESLQKHDPCRTKGRLNINMFPEARPIHALDLMQS
FTKNRHAKQMPIAGTPGPIMKIREKTERSVPMSGGLGGTAGYTVTTESPRKTPQRPFRIP
RTPSDKTPGRQSRVGCVSNLKNSIVEPSSPSQSESRASPEVADRQKRVSLSLKEKGKRFK
KNAERAK
Download sequence
Identical sequences Q19011
6239.D2096.11 D2096.11 NP_501426.3.50509 D2096.11 D2096.11 D2096.11

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]