SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_502855.1.50509 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_502855.1.50509
Domain Number 1 Region: 64-413
Classification Level Classification E-value
Superfamily Serpins 7.49e-16
Family Serpins 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_502855.1.50509
Sequence length 541
Comment Uncharacterized protein CELE_Y73F8A.20 [Caenorhabditis elegans]; AA=GCF_000002985.6; RF=reference genome; TAX=6239; STAX=6239; NAME=Caenorhabditis elegans; strain=Bristol N2; AL=Complete Genome; RT=Major
Sequence
MSDISKSTESRSKKTRSKWNPFHKIVSIVTGKNQQSTESSNSSEGDSPAIRWTTACLNTT
CPIFSRSPQFNMIYSPAPSLMMYVVVTLASEHAMTQTLQRLFGLTDKDMEEIREMSQKLS
ELGAPHQFYCFIRFLVDEQQTTTVSRELMIRSNDVATQQVFSSIRPSRVIKFLNTLTFHP
VSVSRPALFTTNGYASAGLNATWHGEAKKAGLNRFACTFHRKKFEEFFEIRTTYRRVLMD
HFEVIELPFTFGPSSTNFGSLLILRPHFIGNLPYSNRQLTTGALSKMLDTLYSSDWILDG
HLLIPQFSASSCQDLWKNLMRHGVQPDLGQSQKAPPMASLWHWASLKVGSSGISANVKKN
GEKSQTTLHKTFHDRISTDSLLEKHKSYSGRIDSPFSYIVMVHGIPIFTGSYFGSPPPKS
SQVFINAPERIRHRRTIITKKRRNTKITRKQRLLRKVRKSEEKEKEKDRKRAKKALIKNS
NLKKKRKSNSSSSSNGTTETSSTKSSSTSTKVVDVPKEKVIEKSKSSGWRRLANRIFRRK
R
Download sequence
Identical sequences Q9NA52
NP_502855.1.50509 Y73F8A.20 Y73F8A.20 Y73F8A.20 6239.Y73F8A.20

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]