SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_504068.1.50509 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_504068.1.50509
Domain Number 1 Region: 119-359
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.7e-43
Family Nuclear receptor ligand-binding domain 0.0023
Further Details:      
 
Domain Number 2 Region: 25-101
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.18e-23
Family Nuclear receptor 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_504068.1.50509
Sequence length 359
Comment Nuclear Hormone Receptor family [Caenorhabditis elegans]; AA=GCF_000002985.6; RF=reference genome; TAX=6239; STAX=6239; NAME=Caenorhabditis elegans; strain=Bristol N2; AL=Complete Genome; RT=Major
Sequence
MSVYHTPSPSSATSSPLSIDIPQRKCVICLRPAYSNNYGVLTCDACKMFFRRIVILKKDY
KCKYDGRCAHVAKSPMVKCKGCRYQQCLDAGMSFQPTFLELTNEKDLDISVTIGNLVFLD
TRKSRIMKTQFTDDNLSLEQIVDTRRMKMKSRTINKYISPQDWTFLALYTTVDLLLNLDF
MEKLSTPDKLILLRHSASKCALLGGAMRTYLDKKDRMTTVDGQDIYPKEMRALLGFQQGA
DQFLDRVRSLLISKLAELDVTTEECILISAIIFCDPAVFYDQDNPNAQQIVSAQQQNFTS
ALSQYCLLMYHRNGPSRLTNLLSLCPIIQKNFEDLQYLTMVFRLAVKGMKFKKIEQELI
Download sequence
Identical sequences O16389
C17E7.6 6239.C17E7.6 C17E7.6 C17E7.6 NP_504068.1.50509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]