SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_523511.2.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_523511.2.81976
Domain Number 1 Region: 5-257
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.73e-95
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000434
Further Details:      
 
Domain Number 2 Region: 258-464
Classification Level Classification E-value
Superfamily Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 1.96e-60
Family Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.0000234
Further Details:      
 
Domain Number 3 Region: 596-760
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 9.68e-37
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.06
Further Details:      
 
Domain Number 4 Region: 516-592
Classification Level Classification E-value
Superfamily Translation proteins 0.00000000000000183
Family AlaX-M N-terminal domain-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_523511.2.81976
Sequence length 966
Comment Alanyl-tRNA synthetase, isoform A [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MKLLTAKEVRNAYLDFFKEQKHIYVHSSSTIPLDDPTLLFANAGMNQFKPIFLGTADPNS
EMSKWVRVANTQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKKEICSWAWEF
LTQRLALPKDRLYVTYFGGDAASGLEPDLECKQMWLDLGLKPEHILPGSMKDNFWEMGET
GPCGPCSELHFDRIGGRSVPELVNMDDPDVLEIWNLVFIQYNRESDGSLKQLPKKHIDCG
MGFERLVSVIQNKRSNYDTDLFVPLFDAIQAGTGAPPYQGRVGADDVDGIDMAYRVLADH
ARTITIALADGGTPDNTGRGYVLRRILRRAVRYATEKLNAKPGFFATLVNTVVDLLGDAF
PEVKKDPQHIIDIINEEELQFLKTLTRGRNLLNRTIEKLGNQTTIPGDVAWRLYDTYGFP
VDLTQLMAEEKSLKIDMDGYEAAKHNSYVLSQGKGASKIEEINLDVHAISQLQEQGVPPT
NDTFKYKYEAVSDERDSAYNYGVCNSKIVALRFENQFVNEITSGQKAGIVLDKTNFYAES
GGQIYDQGALVKVNDEANEFLVDRVYNRGGYILHIGVVEGTLKVGDELELHIDVERRWLT
MKNHSATHALNHCLLQVLGKDTEQKGSLVVPEKLRFDFNSKAAMTIEQVSKTEQLTKEMV
YKNVPIYAKESKLALAKKIRGLRSVFDEVYPDPVRVISFGVPVDELEQNPDSEAGEQTSV
EFCGGTHLRRSGHIMDFVISSEEAIAKGIRRIVALTGPEALKALKKSEAFEQEIVRLKAT
IDNDKSGKDSKSHVKEIVELTEQISHATIPYVKKDEMRNLLKGLKKTLDDKERALRAAVS
VTVVERAKTLCEANPNATVLVEQLEAFNNTKALDAALKQVRSQLPDAAAMFLSVDADSKK
IFCLSSVPKSAVEKGLKANEWVQHVSATLGGKGGGKPESAQASGTNYEKVDEIVQLASKF
AQSKLS
Download sequence
Identical sequences Q9VLM8 T2FFB7
7227.FBpp0089366 FBpp0079326 FBpp0089366 7297398___KOG0188 NP_523511.2.81976 NP_995656.1.81976 FBpp0079326 FBpp0079326 FBpp0089366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]