SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_523519.2.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_523519.2.81976
Domain Number 1 Region: 967-1113
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 2.09e-35
Family Toll/Interleukin receptor TIR domain 0.00054
Further Details:      
 
Domain Number 2 Region: 243-347,421-501,629-730,793-901
Classification Level Classification E-value
Superfamily L domain-like 8.69e-23
Family Ngr ectodomain-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_523519.2.81976
Sequence length 1125
Comment Toll-4 [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MEHSKLWDLRPEVRERRFKWTSDGQQQQQQQLGWCNNKDDPPNSHQKSKSNNDARNLNSR
VRVRARVRVVPGEMRMGDINCSNGLGNIREDYCEIYLDELGENGTCSIANNEVTTEDYQM
KLVFLKLEINWTSPVFHGWNIFKICNETDYELVIISVLGIRSEVDMRISPAVQYLSLLGI
REISGYDIYLPSVLITEMDVHHANGPKMVTFKYLYDSTVNSVITNNYIRKTMNNTEKIKI
YYHNTFEKTTLTMEKNIFHGKNKMSALIFNGLKIKGLTNNTFENLTSLNTLIFDNVFLKD
LSFLRSSTLQSSLTYCIMKVDNMVDLKSFEKFTNLEIIEVSQYKGFKNFTAFICEPYKSH
CKFTLGINEVACPLKCNCSYNRDKSQLEIDCWQKNLTTIPSLPVPKKGSSALVFQSNLLA
ELPDNSLEGYHNLKSLDVSYNQLTSLSVSQLPESLHYLDIRHNKITTLSPQVVEYLYSVN
VFNQYGNKWSIYCDEYHLQEFFWYKAKLLRIKTSKFQTIMEYIELSSKGSFVENFFVQNI
DQLYLEANEDEIIDAFGPSDKYFNLKLMEALNHAIWLFSGEFDEIILHHLNSPCPYRCSC
CFEWHTGEFLINCRNLSLDIYPRLPNSIPYKTTLYLDRNEIRKLTNTESLVVAGHASIHK
LHMSQNLLRELPLHLLPENITYLDVRNNLLKYLDDGVIAFLEYRENITKIELSGNPWECN
CKAKAFLSFLRRHEPMEYETVLRRVEITDDKCPEDCICCVDTSNSDSLAYVVDCSGKELS
EIPQLPTPTYGQTTLVFERNSLKKWPSSLLPGYSSVTRFYLAHNRLSDIDQLPDKLEYLD
ISNNNFSALDDRVRGFLQKRMNSSQLQLSLFGNPWTCRCEDKDFLVFVKEQAKNIANASA
IQCIDTGRSLIEVEETDICPSVLIYYTSLAVSLLIIALSINVFICFRQPIMIWFYEHEIC
LSLAARRELDEDKKYDAFLSFTHKDEDLIEEFVDRLENGRHKFRLCFYLRDWLVGESIPD
CINQSVKGSRRIIILMTKNFLKSTWGRLEFRLALHATSRDRCKRLIVVLYPDVEHFDDLD
SELRAYMVLNTYLDRNNPNFWNKLMYSMPHASHLKRSRSDAETKV
Download sequence
Identical sequences Q9VLE6
7227.FBpp0079369 FBpp0079369 FBpp0079369 FBpp0079369 NP_523519.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]