SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_523539.2.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_523539.2.81976
Domain Number 1 Region: 147-312
Classification Level Classification E-value
Superfamily L domain-like 9.69e-26
Family Internalin LRR domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_523539.2.81976
Sequence length 428
Comment Leucine-rich repeat 47, isoform A [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MKILCEVQVVNRATQTNKTPRPVKSTLAIGYKQSARDANGNTKKELEMVLFSGQNKTGNR
YKVKDNIHVVHTKFVLDGKTTIGFIQPPDNLLIKCDPIQLKGFLQTLKLGMDGKDAINLR
LNINAATAIPQKAQPQVRMVISKRSEYPIKGFPRTLKSLTINNSQLVKLSFEICTLRNLT
KLDVSGNKLTKIPSELGRLPLTSLHLGNNLLGTQNDWCWLRGTKLCQSLGELDLSGNGLT
YFPPPLVKFESLVSLNLNNNLLSRLPFAIRRMKALRKLYVCSNELESLPSAVEDLRIDLL
DVWGNCFKEFNADAAQQMYLQKAASNSPQPLWLLGARAVDKYMLPLSAGSIPAVLIDLIR
EAPRCPCGELCYAQRKEDLFQRVVQPKFITVKNLTYSREHQIYADVVLCDSRCSASAELK
LLFNIIFS
Download sequence
Identical sequences Q9VKU0
7227.FBpp0079681 NP_001260355.1.81976 NP_523539.2.81976 FBpp0079681 FBpp0304061 FBpp0079681 FBpp0079681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]