SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_523575.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_523575.1.81976
Domain Number 1 Region: 85-321
Classification Level Classification E-value
Superfamily L domain-like 1.29e-41
Family Ngr ectodomain-like 0.0036
Further Details:      
 
Domain Number 2 Region: 327-432
Classification Level Classification E-value
Superfamily Immunoglobulin 1.99e-17
Family I set domains 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_523575.1.81976
Sequence length 1021
Comment kekkon-3, isoform A [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MAAGRAAATLEAPGPPSGQDIASDNSAQRRTLATKVRRKGPRPQRRLHPPLRPRLPLHLH
LLLWLLCCCSQLGQLRAECPAVCECKWKSGKESVLCLNANLTHIPQPLDAGTQLLDLSGN
EIQLIPDDSFATAQLLNLQKVYLARCHLRLIERHAFRKLINLVELDLSQNLLSAIPSLAL
YHVSELRELRLSGNPILRVPDDAFGHVPQLVKLELSDCRLSHIAVRAFAGLESSLEWLKL
DGNRLSEVRSGTITSLASLHGLELARNTWNCSCSLRPLRAWMLQQNIPSGIPPTCESPPR
LSGRAWDKLDVDDFACVPQIVATDTTAHGVEGRNITMSCYVEGVPQPAVKWLLKNRLIAN
LSAGGDGDSDSEPRTAAATQGRKTYVVNMLRNASNLTILTADMQDAGIYTCAAENKAGKV
EASVTLAVSRRPPEAPWGVRIILLGAVAALLLVGGSSFAAICLCSLQRRRKLRLWNSVPP
VRRSESYEKIEMTARTRPDLGGGASCGGGSATGAGLFHDAEEQGYLRAAHTPLNDNDAGQ
AAAIVNPSAGSAQRRNGDYLHVSTHCDDEEEDQQLHHHPQQQPASQHHPHPNQQQHQQRK
GSQGHVVSASGANNSAPLEETDLHIPRLIDIGGTDSASSSISSQVDAAARLAGYAGHTWK
TTPIATTKINSPHSKPVTSAAPSSLNTQATPYAHYGNHPADEMATSVFCSEGQESDLFDS
NYPDLLDIAKYAVAQAQQEGRGQGYAQATTTPNGGLCTLPRKLKTSGKYFRNSSDSQSPL
LADNSSKYGSSTLGDGSFLNEAMGLGRRYSAESSYANYSSTATYTGGGQRANSFLNLVQS
GAHQGKLLPSHLGQKPSLPSSPVQHQRSLSSAATPLLDFSALASRAAGAANTSVAAYDYH
AAQLERFLEEYRNLQDQLCKMKETCDTIRKKETPLRVAIGQSAAQLADPVMYSAASHSPK
PPATSNLKTKTLLPGQPPDPPPYWLHRNAMLKRLNGDGSAGTNGSGGSPASPQPRQDIFK
S
Download sequence
Identical sequences Q9V430
NP_001162986.1.81976 NP_523575.1.81976 7227.FBpp0080311 FBpp0080311 FBpp0080311 FBpp0290072 FBpp0080311 FBpp0290072

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]