SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_523613.4.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_523613.4.81976
Domain Number 1 Region: 454-719
Classification Level Classification E-value
Superfamily TPR-like 2.69e-16
Family Tetratricopeptide repeat (TPR) 0.019
Further Details:      
 
Domain Number 2 Region: 184-327,429-474
Classification Level Classification E-value
Superfamily TPR-like 0.000000000000131
Family Tetratricopeptide repeat (TPR) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_523613.4.81976
Sequence length 840
Comment no mechanoreceptor potential B, isoform C [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MTSQITANGTQRLPEPVSEHEAVPPPPPTAAGRPRPPTSQLFSRGNLASSRATGGDKSGL
ARPSTAVRAVGYAANCESAHQRFEQFFLEKAKQQTLSSRAAVDAIKDVNPQMKYKNLEEK
IVKLLESSIVLAWQGSPNKLLNLDTKLAEALSKAKEAFSLDRTLHQFRDQHGENVYHNFD
LTYAVFFNLAEQYERSEMHIEALNTYSIMAKNKMFPHVNQLKLNMGNIYYSMGIYQKAVK
MYRMALDSVPKSLSQLRLKIRENIGILFIRMGSYSDAASSFEFIMTERANIRSSIHLLLC
YFALGDVEKVKLAFRRLCDVQTEAIESDMESETNIIKLQQQAEPIQQIGETDGYQSLNNE
PVTGSVIKAEGGGKLNETVKFAATVKHRYVVQALKKDELAVYRNERRNAVKRSITMIVDL
ISPFIEDNYNDGYNWCIEIIKTSNLAWLANELELNKALVYLRQNDVHQAIETLQMYDRKS
EGSMTASALTNLSFIYISLGNLEMASHCVNQLHEIGSLKNNAPGLINAGIVELGSHNLIL
ASERFEGALQLQPMNFEARYNLGLVALAQNDYELAEERFELLKEQLMLPSSVQHSHVFYQ
LAKLQERRLESGLISNFTPGAALQAYLQVVGISASDIDSRLFEKVGSLYEQIQDHQEANQ
YYNEAYRINMSDIGIASSIGSYYIKLQATERALFYYERAVLADPNDPNLMLRIASCFRNS
YLPTKQYLGLFQKIHARFPDNLTCIRALMQVTKSLELGDLYERYASEYTRLQSQQQERQS
EQRYQQQRFPSAAKFSNRLRFLQFDPLGPPAERPKTGRPLQSRDDVDDDAEMNPESLLPI
Download sequence
Identical sequences Q9V9R6
NP_523613.4.81976 FBpp0290395 FBpp0290395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]