SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_523665.2.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_523665.2.81976
Domain Number 1 Region: 92-118
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000848
Family CCCH zinc finger 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_523665.2.81976
Sequence length 180
Comment uncharacterized protein Dmel_CG42382 [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MSLVADYSDSSESDEDSSGQFSEDGETKSAAPAKNEKTPPPKLPSASQAFSQGAGKGDVF
NNPFLEAELHKTASLERHVKMVDNDAHQKLKNGRKICWNFRRGRCRFGTSCQYAHDSDLS
VDEAAEKSALPDQSVPVVVEAAPGNFNRRKRPGLGDALEPGKRVMKSYKQQNPQNPFARR
Download sequence
Identical sequences A1Z7R9
FBpp0289271 7227.FBpp0289271 FBpp0289271 FBpp0289271 NP_523665.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]