SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_523938.2.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_523938.2.81976
Domain Number 1 Region: 117-266
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.53e-44
Family Hypothetical protein AT3g04780/F7O18 27 0.0000897
Further Details:      
 
Domain Number 2 Region: 2-108
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.84e-30
Family Thioltransferase 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_523938.2.81976
Sequence length 287
Comment Thioredoxin-like [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MSVRVINDESHFQAELAQAGIQLVVVDFTASWCGPCKRIAPIFETFPTKYPKAIFLKVDV
DKCQDTAAGQGVSAMPTFIFYRNRTKIDRVQGADVNGLEAKIQEHIGTSGGEEGGEDYGQ
GLMELNTFISKQECECLNEADDHNLKHALASAGGYLQSDCDEQLILSITFNQAVKIHSLK
FKAPSHLGPKDVKLFINQPRTIDFDMAESMNSVQDLSLAQKELESGVPVNLRYVKFQNVQ
NIQIFVKNNQSGGDVTQIDYIGFIGSPIMTTKMNDFKRVAGKKGESH
Download sequence
Identical sequences Q9VRP3
FBpp0076804 FBpp0076804 NP_523938.2.81976 FBpp0076804 7227.FBpp0076804

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]