SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_524111.3.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_524111.3.81976
Domain Number 1 Region: 572-776
Classification Level Classification E-value
Superfamily NTF2-like 2.19e-33
Family NTF2-like 0.0064
Further Details:      
 
Domain Number 2 Region: 420-565
Classification Level Classification E-value
Superfamily L domain-like 4.76e-16
Family mRNA export factor tap 0.0069
Further Details:      
 
Domain Number 3 Region: 164-285
Classification Level Classification E-value
Superfamily L domain-like 0.0000000238
Family mRNA export factor tap 0.045
Further Details:      
 
Domain Number 4 Region: 792-840
Classification Level Classification E-value
Superfamily UBA-like 0.00000156
Family TAP-C domain-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_524111.3.81976
Sequence length 841
Comment nuclear RNA export factor 2, isoform A [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MPNQMRVLDFGDGSVPIQLDYPDSKIFSKCSSYGDRVPGTHWNEITVHHKGRLEYSPNPE
QIILDALYQAIDGADFFPVFYQRGKNMDTMLVRNCKAAIDKLFKQRLSINLKGGASIPIS
IQLGVAQYQRHQITPTFHIARVVTRLMKQLIQRDGVDGLLNLDNFGSHPEFKNLVVSLGN
PSILMNVCQVIHNDDNERFRLNGFILSNNRIRDIRPLTLLANVDYALLDLRGNKIKSAER
LCRALEQFRARELLLENNPIVKISNFPANIKSLESNFELVDGKPFNMLHKIFSPLDVEID
LEVDGARIDTNNMWKLPEFENSQHWHAFMIPDPSHEFNQEVFFDFFFIRLDPTLSNFYPC
YYKYINTEHVFLVRNCFDQIAHLVNNCNLEMTIPTGDRIFRYYLRMNVSTVKQHHVDPEE
CIQKAVSQCYVAQNRMLNLERFHSRECLKDVMVSLSSPKILTYVLSVASRKFMTTCSEIR
LCHNKVLVLDGAHVLGMMGCLRAVDLSHNWVQDLSSIHSLGNLPLKSLVLHGNKLCRNYR
LPSEYVRAVKEVFPQLTTLDGVDLQTNPGQSLQKNFLCDTGAYELVGAFLENYLREFEND
EFRHNLYKYYSENSIFTLTCNYNVVQNHQTPKILQRLSKYNRHARNLRNKDYSKASDGVF
FGCTYIVEILLQLPRVTHDFHSLQTDVMHYNGKGAVIYVAGLLRDEPPSTRNGHGSKTDI
GGVLLGFSRQFVVTFDEANLGLGKRARRLKIANERLHITNPSKTAIRNAFSVNFPDPSER
QAEEDSLDVKDHKLLLFQEVTGLISTWVTSIVEEADWDFERALKLFIQKNADHEIPDLAF
A
Download sequence
Identical sequences Q9VV73
NP_524111.3.81976 NP_730179.2.81976 FBpp0088483 FBpp0088483 FBpp0088484 FBpp0088483 FBpp0088484 7227.FBpp0088483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]