SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_524274.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_524274.1.81976
Domain Number 1 Region: 423-596
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.74e-54
Family Single strand DNA-binding domain, SSB 0.00000565
Further Details:      
 
Domain Number 2 Region: 284-404
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 9.42e-34
Family Single strand DNA-binding domain, SSB 0.0000849
Further Details:      
 
Domain Number 3 Region: 167-277
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.06e-33
Family Single strand DNA-binding domain, SSB 0.0000161
Further Details:      
 
Domain Number 4 Region: 4-117
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 7.71e-29
Family Single strand DNA-binding domain, SSB 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_524274.1.81976
Sequence length 603
Comment replication protein A 70 [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MVLASLSTGVIARIMHGEVVDAPVLQILAIKKINSAADSERYRILISDGKYFNSYAMLAS
QLNVMQHNGELEEFTIVQLDKYVTSLVGKDGAGKRVLIISELTVVNPGAEVKSKIGEPVT
YENAAKQDLAPKPAVTSNSKPIAKKEPSHNNNNNIVMNSSINSGMTHPISSLSPYQNKWV
IKARVTSKSGIRTWSNARGEGKLFSMDLMDESGEIRATAFKEQCDKFYDLIQVDSVYYIS
KCQLKPANKQYSSLNNAYEMTFSGETVVQLCEDTDDDPIPEIKYNLVPISDVSGMENKAA
VDTIGICKEVGELQSFVARTTNKEFKKRDITLVDMSNSAISLTLWGDDAVNFDGHVQPVI
LVKGTRINEFNGGKSLSLGGGSIMKINPDIPEAHKLRGWFDNGGGDSVANMVSARTGGGS
FSTEWMTLKDARARNLGSGDKPDYFQCKAVVHIVKQENAFYRACPQSDCNKKVVDEGNDQ
FRCEKCNALFPNFKYRLLINMSIGDWTSNRWVSSFNEVGEQLLGHTSQEVGEALENDPAK
AEQIFSALNFTSHIFKLRCKNEVYGDMTRNKLTVQSVAPINHKEYNKHLLKELQELTGIG
SSN
Download sequence
Identical sequences Q24492
FBpp0081356 NP_524274.1.81976 FBpp0081356 7227.FBpp0081356 FBpp0081356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]