SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_524305.2.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_524305.2.81976
Domain Number 1 Region: 12-137
Classification Level Classification E-value
Superfamily Rap30/74 interaction domains 4.45e-30
Family Rap30/74 interaction domains 0.0002
Further Details:      
 
Domain Number 2 Region: 193-259
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.2e-23
Family DNA-binding domain from rap30 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_524305.2.81976
Sequence length 277
Comment transcription factor TFIIFbeta [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MSKEDKEKTQIIDKDLDLSNAGRGVWLVKVPKYIAQKWEKAPTNMDVGKLRINKTPGQKA
QVSLSLTPAVLALDPEEKIPTEHILDVSQVTKQTLGVFSHMAPSDGKENSTTSAAQPDNE
KLYMEGRIVQKLECRPIADNCYMKLKLESIRKASEPQRRVQPIDKIVQNFKPVKDHAHNI
EYRERKKAEGKKARDDKNAVMDMLFHAFEKHQYYNIKDLVKITNQPISYLKEILKDVCDY
NMKNPHKNMWELKKEYRHYKTEEKKEEEHKSGSSDSE
Download sequence
Identical sequences P41900
FBpp0081786 7227.FBpp0081786 FBpp0081786 FBpp0081786 NP_524305.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]