SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_524373.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_524373.1.81976
Domain Number 1 Region: 446-552
Classification Level Classification E-value
Superfamily Homeodomain-like 1.08e-35
Family SWIRM domain 0.0000712
Further Details:      
 
Domain Number 2 Region: 652-702
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000748
Family Homeodomain 0.052
Further Details:      
 
Domain Number 3 Region: 149-199,240-278
Classification Level Classification E-value
Superfamily BRCT domain 0.00000392
Family BRCT domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_524373.1.81976
Sequence length 1209
Comment moira, isoform A [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MNTLGPKKDGSPNIDFFQSPETLQGFESIRQWLQKNCKKYLAHSSEPITKESLAQLLIHF
LQYVEAKLGKNSADPPATRIPMRCFLDFKSGGGLCIIFSTMFRFRAEQRGKKFDFSIGKN
PTRKDPNIQLLIEIEQALVEADLYRIPYIYIRPEIEKGFEGKLREILDNRRVEIVSDEED
ATHIVYPVVDPHPDEYARPIFKRGGHVMLHWYYFPESYDSWAVNNFDLPDHIPENPESPA
ERWRVSASWIVDLEQYNEWMAEEDYEVDEQGKKKTHKQRMSIDDIMSFGDEKKKPAASSG
GGKQKRRRSPSPASSASTSKPGKRKRSPAVVHKKSRNDDDDEDLTRDLDDPPAEPNVQEV
HKANAALQSTASPAPGGKSRGDNDMMPIKGGTMTDLDDEMTGGSAAQAMSTGDGENSQTG
KTSDNSNTQEFSSSAKEDMEDNVTEQTHHIIVPSYSAWFDYNSIHVIEKRAMPEFFNSKN
KSKTPEIYMAYRNFMIDTYRLNPTEYLTSTACRRNLAGDVCAIMRVHAFLEQWGLINYQI
DADVRPTPMGPPPTSHFHILSDTPSGLQSINPQKTQQPSAAKTLLDLDKKPLGKDGGLEL
GDKSGLTGIKTEALENGAAGGLSSGVSQFGLKLDQYAKKPAAMRNRTAASMAREWTDQET
LLLLEGLEMHKDDWNKVCEHVGSRTQDECILHFLRLPIEDPYLEDDGGFLGPLACQPIPF
SKSGNPIMSTVAFLASVVDPRVAAAAAKAAMEEFAAIKDEVPATIMDNHLKNVEKASAGG
KFNPNFGLANSGIAGTGNDKDDEEGKEGGASASAGGSDEEMKDLSKKDDDAKSKDNTKSD
KTNTNTDSSSTSSSATGNTNNTDKKPKESSGSSPSGDKSAIKSDKSNKSSPTETAAAASG
GEVDIKTEDSSGDGETKDGTEAKEGTGTGTGPLAVPKEGTFSENNMQTAAAAALASAAVK
AKHLAALEERKIKSLVALLVETQMKKLEIKLRHFEELEATMEREREGLEYQRQQLITERQ
QFHLEQLKAAEFRARQQAHHRLQQELQGQAAAGSMILPQQQQLPQAQQPQQQQQTLPPHP
HLAQQQQLPPHPHQLPPQSQPLAGPTAQHQPLPPHVVSSPNGAPFAAPPISLTGGLPPGA
PTAIVTNPSDQTGPVAAGAAQSQAPTPMDTTPPSSGPVSDANAPPGSAMPPGGIPPANTA
PIAGVAPSS
Download sequence
Identical sequences Q9VF03
7227.FBpp0082692 FBpp0082692 FBpp0082692 NP_524373.1.81976 FBpp0082692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]