SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_524625.3.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_524625.3.81976
Domain Number 1 Region: 733-1016
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.34e-81
Family Protein kinases, catalytic subunit 0.00000000537
Further Details:      
 
Domain Number 2 Region: 85-259
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.15e-47
Family Ephrin receptor ligand binding domain 0.0000312
Further Details:      
 
Domain Number 3 Region: 386-626
Classification Level Classification E-value
Superfamily Fibronectin type III 4.18e-26
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 4 Region: 1035-1092
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000000236
Family SAM (sterile alpha motif) domain 0.0026
Further Details:      
 
Domain Number 5 Region: 287-386,435-445
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000148
Family Growth factor receptor domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_524625.3.81976
Sequence length 1096
Comment Eph receptor tyrosine kinase, isoform C [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MKMVGCHPNDKKVKYDGIKSKTSSVTILTSVLNDAISALKSAFYKNQAPISEQNRSQIVS
RMSLLRTILLIIISIHFKLAHADQVVLLDTTREATLEWTRYPYGPQAQTPGWVEESFTDF
VKGINWRSYVVCDVAYHNVNNWLWSPFIDRGSANRLYIEIQFTIRDCSLFPGNALSCKET
FSLLFYEFDAATREPPPWQTDSYRLIARIAAGEGRFNQNSDVDINTEVKSIAVNKKGVYF
AFRDQGACISVLAVKVYYITCPAVTENFAHFNETPTGREITIIEKQNGTCVDNAEPYETP
TYLCKGDGKWTILTGGCRCKAGYEPNYTNKTCTECPLGTFKSPEVTKCTPCPPNSNASKT
GSPFCKCASGFYRHPNDGRHMPCYSPPAAPTNLTLLFVDQTSAIISWSAPAKNESFSSET
NSKIYHSDIVYKIKCNICSPNVVYNPSTDTFNETKITLTNLEPVTTYTVQIHAINSVSHI
NEFKRHSNESSLVAVSDIVFSNTSLLNIPLDLNEVKTGQAEIVFTTESVLLSTVFNLRIL
AITNKDADLEWDKPVQSDFPLEFYEVRWFPKVELDAINKSALNTKETKAHIVGLLENTEY
GFQVRCKTNNGFGSYSNMIYAQTLQSVGSVYDDSVQIRFIAGAIVTGVLFLVIFIIATVY
FMRSKHQDDLDKKSTNHLPLPLDYASNEVNSMDTTPIVKKLHLNVTTPLFGNSRSYVDPH
TYEDPNQAIREFAREIDANYITIEAIIGGGEFGDVCRGRLKIPPNFVQDIDVAIKTLKPG
SSEKARCDFLTEASIMGQFDHPNVIYLQGVVTRSNPVMIITEYMENGSLDTFLRVNDGKF
QTLQLIVMLRGIASGMSYLSDMNYVHRDLAARNVLVNAQLICKIADFGLSREIENASDAY
TTRGGKIPVRWTAPEAIAFRKFTSASDVWSYGVVLWEVMSYGERPYWNWSNQDVIKSIEK
GYRLPAPMDCPEALYQLMLDCWQKQRTHRPTFASIVSTLDNLARQPQSLLTTRPSPESDG
NHILDGQRGQNIFISTDLWLEHIKMSRYCHHFKEANLINAQQISRLTAQQLSDMGITLVG
HQKKILHQARQLDTII
Download sequence
Identical sequences Q9V4E5
7227.FBpp0088153 FBpp0088153 FBpp0088153 FBpp0088155 NP_524625.3.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]