SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_524754.2.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_524754.2.81976
Domain Number 1 Region: 9-255
Classification Level Classification E-value
Superfamily L domain-like 1.09e-52
Family Internalin LRR domain 0.012
Further Details:      
 
Domain Number 2 Region: 195-392
Classification Level Classification E-value
Superfamily L domain-like 2.04e-39
Family Internalin LRR domain 0.027
Further Details:      
 
Domain Number 3 Region: 716-819
Classification Level Classification E-value
Superfamily PDZ domain-like 1.58e-24
Family PDZ domain 0.00097
Further Details:      
 
Domain Number 4 Region: 1239-1329
Classification Level Classification E-value
Superfamily PDZ domain-like 2.37e-24
Family PDZ domain 0.0037
Further Details:      
 
Domain Number 5 Region: 1331-1429
Classification Level Classification E-value
Superfamily PDZ domain-like 2.63e-22
Family PDZ domain 0.00033
Further Details:      
 
Domain Number 6 Region: 926-1029
Classification Level Classification E-value
Superfamily PDZ domain-like 3.15e-21
Family PDZ domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_524754.2.81976
Sequence length 1851
Comment scribbled, isoform D [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MFKCIPIFKGCNRQVEFVDKRHCSLPQVPEEILRYSRTLEELFLDANHIRDLPKNFFRLH
RLRKLGLSDNEIGRLPPDIQNFENLVELDVSRNDIPDIPDDIKHLQSLQVADFSSNPIPK
LPSGFSQLKNLTVLGLNDMSLTTLPADFGSLTQLESLELRENLLKHLPETISQLTKLKRL
DLGDNEIEDLPPYLGYLPGLHELWLDHNQLQRLPPELGLLTKLTYLDVSENRLEELPNEI
SGLVSLTDLDLAQNLLEALPDGIAKLSRLTILKLDQNRLQRLNDTLGNCENMQELILTEN
FLSELPASIGQMTKLNNLNVDRNALEYLPLEIGQCANLGVLSLRDNKLKKLPPELGNCTV
LHVLDVSGNQLLYLPYSLVNLQLKAVWLSENQSQPLLTFQPDTDAETGEQVLSCYLLPQQ
EYQPITPARDLESDSEPFEEREPSRTVVKFSEEATQEKETPFVRQNTPHPKDLKAKAQKL
KVERSRNEEHANLVTLPEENGTKLAETPTETRTIANNHQQQPHPVQQPIVGVNSKQPVVV
GVVTPTTTTVAPTGVQGGSEGASSTANNVKAATAAVVAELAATVGGSDEVQDDDEQEDEF
ESDRRVGFQVEGEDDDFYKRPPKLHRRDTPHHLKNKRVQHLTDKQASEILANALASQERN
DTTPQHSLSGKVTSPIEEEEQLEVEQEQQQQQQQHPFDSSLSPISAGKTAEASTDPDNLD
GVTELRLEQYEIHIERTAAGLGLSIAGGKGSTPFKGDDDGIFISRVTEAGPADLAGLKVG
DKVIKVNGIVVVDADHYQAVQVLKACGAVLVLVVQREVTRLIGHPVFSEDGSVSQISVET
RPLVADAPPAASISHERYIPAPIEIVPQQQHLQQQQQQPIQQVAPTHSYSGNVFATPTAA
QTVQPAVSAAPNGLLLNGREAPLSYIQLHTTLIRDQIGQGLGFSIAGGKGSPPFKDDCDG
IFISRITEGGLAYRDGKIMVGDRVMAINGNDMTEAHHDAAVACLTEPQRFVRLVLQREYR
GPLEPPTSPRSPAVLNSLSPSGYLANRPANFSRSVVEVEQPYKYNTLATTTPTPKPTVPA
SISNNNNTLPSSKTNGFATAAAATIDSSTGQPVPAPRRTNSVPMGDGDIGAGSTTSGDSG
EAQPSSLRPLTSDDFQAMIPAHFLSGGSQHQVHVARPNEVGVSAVTVNVNKPQPDLPMFP
AAPTELGRVTETITKSTFTETVMTRITDNQLAEPLISEEVVLPKNQGSLGFSIIGGTDHS
CVPFGTREPGIFISHIVPGGIASKCGKLRMGDRILKVNEADVSKATHQDAVLELLKPGDE
IKLTIQHDPLPPGFQEVLLSKAEGERLGMHIKGGLNGQRGNPADPSDEGVFVSKINSVGA
ARRDGRLKVGMRLLEVNGHSLLGASHQDAVNVLRNAGNEIQLVVCKGYDKSNLIHSIGQA
GGMSTGFNSSASCSGGSRQGSRASETGSELSQSQSVSSLDHEEDERLRQDFDVFASQKPD
AQQPTGPSVLAAAAAMVHGASSPTPPAATSNITPLPTAAAVASADLTAPDTPATQTVALI
HAEQQAHQQQQQTQLAPLGQEKSTQEKVLEIVRAADAFTTVPPKSPSEHHEQDKIQKTTT
VVISKHTLDTNPTTPTTPAAPLSIAGAESANSAGAPSPAVPASTPGSAPVLPAVAVQTQT
QTTSTEKDEEEESQLQSTPASRDGAEEQQEEVRAKPTPTKVPKSVSDKKRFFESAMEDQH
KPTQKTDKVFSFLSKDEVEKLRQEEERKIATLRRDKNSRLLDAANDNIDKDAAQQRTKSN
SNSSSGDDNDDSDQEEGIARGDSVDNAALGHFDDAEDMRNPLDEIEAVFRS
Download sequence
Identical sequences Q7KRY7
FBpp0291309 NP_524754.2.81976 FBpp0300849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]