SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_524768.2.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_524768.2.81976
Domain Number 1 Region: 35-61,201-280
Classification Level Classification E-value
Superfamily SET domain 0.0000000000376
Family Histone lysine methyltransferases 0.061
Further Details:      
 
Domain Number 2 Region: 54-104
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.0000000000401
Family MYND zinc finger 0.0082
Further Details:      
 
Domain Number 3 Region: 364-464
Classification Level Classification E-value
Superfamily TPR-like 0.0000152
Family Tetratricopeptide repeat (TPR) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_524768.2.81976
Sequence length 468
Comment SET and MYND domain containing, class 3 [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MATATVGSSRSATTSATASACSSKSKNLKNPAPQIKRGQRILTEKPFAFVLKSQYRLERC
DNCLEATKVLKCSNCRYVSYCHRSCQMQAWGQHKHECPFLKKVHPRVVPDAARMLCRLIL
RLEHGGDLIRGYYTEHGSRKFRDLMSHYAEIKNDPMRLEHLDSLHAVLTDMMAESPSTVP
NKTELMSIYGRLITNGFNILDAEMNSIATAIYLGVSITDHSCQPNAVATFEGNELHVHAI
EDMECLDWSKIFISYIDLLNTPEQRRLDLKEHYYFLCVCSKCTDAKESKEMLAALCPNRN
CGAGISVDRNNCPRCDAGISPKLRNAFNEAMTLTRHNLENMKDVAYLDVCKVCLDKQTGV
FHPLNVWYVKTLDAAFEAAIEVGKWSDALDYGQRLLPGFRKYHGPWNPLLGLLHMKLGKI
QLYEGHSKEALHHLEEAQRILTVTHGRDHRLLTEQLYMLVLQARQEAH
Download sequence
Identical sequences Q9W4X8
FBpp0070431 7227.FBpp0070431 FBpp0070431 NP_524768.2.81976 FBpp0070431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]