SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_525017.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_525017.1.81976
Domain Number 1 Region: 81-224
Classification Level Classification E-value
Superfamily L domain-like 2.04e-17
Family U2A'-like 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_525017.1.81976
Sequence length 280
Comment misexpression suppressor of KSR 4, isoform A [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MSGTSTSERSNSEDSPLNPCLTEVLRNCANIQSLESLNYEYNDVLLTEDNVGKMITPNPY
SFSGNISISSCPSEDVSFSESILEDNGRISLAYENLKTIPRRLADKFAAQTKFLDLSHND
FRNLRFLSFFEDLDTLILDRNVNLDINTFPYLPSLRILWINNCDIANITDWIHRIERHCP
ALDQLSCMGNPGIRTVFGGQGPREYILQVLPQLKYLDGLPTSRNAAYATLSSSQGQGPDS
TSNSEKPPLASAFTFKDIIRPKYSRKSHSGRMFGNGSSTN
Download sequence
Identical sequences Q9GU54
FBpp0082810 FBpp0082812 FBpp0082810 FBpp0082812 FBpp0082810 FBpp0082812 NP_001262650.1.81976 NP_525017.1.81976 NP_732186.1.81976 7227.FBpp0082810 7227.FBpp0082812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]