SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_542785.1.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_542785.1.87134
Domain Number 1 Region: 356-432
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 3.66e-21
Family Intermediate filament protein, coiled coil region 0.0007
Further Details:      
 
Domain Number 2 Region: 124-158
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000000298
Family Intermediate filament protein, coiled coil region 0.0017
Further Details:      
 
Domain Number 3 Region: 165-234
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000209
Family Intermediate filament protein, coiled coil region 0.008
Further Details:      
 
Weak hits

Sequence:  NP_542785.1.87134
Domain Number - Region: 253-356
Classification Level Classification E-value
Superfamily Prefoldin 0.00314
Family Prefoldin 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_542785.1.87134
Sequence length 511
Comment keratin, type II cytoskeletal 72 isoform 1 [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MSRQLTHFPRGERLGFSGCSAVLSGGIGSSSASFRARVKGSASFGSKSLSCLGGSRSLAL
SAAARRGGGRLGGFVGTAFGSAGLGPKCPSVCPPGGIPQVTVNKSLLAPLNVEMDPEIQR
VRAQEREQIKALNNKFASFIDKVRFLEQQNQVLETKWNLLQQLDLNNCRKNLEPIYEGYI
SNLQKQLEMLSGDGVRLDSELRNMQDLVEDYKKRYEVEINRRTAAENEFVVLKKDVDAAY
MNKVELQAKVDSLTDEIKFFKCLYEGEITQIQSHISDTSIVLSMDNNRDLDLDSIIAEVR
AQYEEIALKSKAEAETLYQTKIQELQVTAGQHGDDLKLTKAEISELNRLIQRIRSEIGNV
KKQCADLETAIADAEQRGDCALKDARAKLDELEGALHQAKEELARMLREYQELVSLKLAL
DMEIATYRKLLESEECRMSGEYPNSVSISVISSTNAGAGGAGFSMGFGASSSYSYKTAAA
DVKTKGSCGSELKDPLAKTSGSSCATKKASR
Download sequence
Identical sequences Q14CN4
ENSP00000293745 ENSP00000441160 ENSP00000293745 ENSP00000441160 9606.ENSP00000293745 gi|226246663|ref|NP_001139697.1| gi|28372503|ref|NP_542785.1| ENSP00000346269 NP_001139697.1.87134 NP_001139697.1.92137 NP_542785.1.87134 NP_542785.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]