SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_569858.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_569858.1.81976
Domain Number 1 Region: 316-499
Classification Level Classification E-value
Superfamily MIR domain 4.19e-59
Family MIR domain 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_569858.1.81976
Sequence length 765
Comment twisted, isoform A [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MAASVVKTPKCPRRGSVKDVAQNAPRTAPTSSKEANWNWWLLLATVFLVTFATRFYKVTE
PDHICWDETHFGKMGSWYINRTFFFDVHPPLGKMLIGLSGYLTGYNGTFPFEKPGDKYNE
TRYQGMRYFCTTLGALIMPMGFDTVYDLTRSHEAALLAAAYLIFDVGLLTLNQYILLDPI
LLFFMMASVWGMVKVSKSTASGGSYGLRWWLWLFLTGTMLSCTISVKFVGLFVVLLVGLH
TATELWLILGDLGQPILETVKQLACRAITLIVWPVLLYILFFYIHLSVLNRSGNGDGFYS
SAFQSRLIGNSLYNASMPRDVAYGSLVTIKNHKTGGGYLHSHHHLYPKGSGARQQQVTTY
THKDENNKWLIRPHNKPGPPKGKVQILRHGDLVRLTHMATRRNLHSHNEPAPMTKKHLQV
TGYGELGLGDANDVWRVLIVGGKVNETVHTVTSRLKFIHLLQNCALTSSGKQLPKWGFEQ
QEVSCNPNVRDKNSQWNVEDNEHKLMPSVSFSVYAPGFFARFLESHAVMLQGNAGLKPKE
GEVTSRPWQWPINYRGQFFSGSSYRIYLLGNPLIWWSNLVFLALFVTVFLCNAVVQQRRA
GFARSAAQNQAQVPDSETVAQDEESEHSTTDICSCCTPAKEIVPKAVPSGSPEAPNPAQS
LRAAAWLFLGWMLHYLPFWAMGRVLYFHHYFPALIFNSLLTGVMYNYILRVLPKWIHHVI
LGLVLSILVYSFAAFSPLAYGMSGPLANEPNSTMYNLKWLSTWEF
Download sequence
Identical sequences M9PG53 Q9W5D4
NP_001259102.1.81976 NP_569858.1.81976 FBpp0070134 FBpp0070134 7227.FBpp0070134 FBpp0070134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]