SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_570022.2.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_570022.2.81976
Domain Number 1 Region: 259-443
Classification Level Classification E-value
Superfamily TRAF domain-like 1.05e-28
Family SIAH, seven in absentia homolog 0.0019
Further Details:      
 
Domain Number 2 Region: 198-249
Classification Level Classification E-value
Superfamily RING/U-box 0.00000244
Family RING finger domain, C3HC4 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_570022.2.81976
Sequence length 626
Comment CG2681 [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MSTLANGGKEEDLKILAQLKSIEQINEQRRIFLNSTINEEVPEATNGSTVREEDLEKNLK
AIDEPQSTKMPPEEVAKKTPDEVPAQEQQKEPEKVEPAKPVPPNTLTLNVKYATLPSPNV
VTLRSPLSPPPKPPMLGRTRSTGPADGKGPASNGALSPDSSIIRQSFPEGVITPSKPEKS
PATPSEEGPPTVSARHYEGLIEELRCPGCAGAMKAPILLCKSGHSVCEQCTRILLMCPLC
KEPFTNSRSLTVEALCAKAHFRCGHASGGCQVRMPVVLLPWHEQQCMYKPMKCFMGRVWG
DCRWQGREVQWKEHLEEQHDDRLFRSSSADLEWNLGTRRKPLTGYYVFQAHDEMFNFYEI
HDRQRVLFTMTCTSNRRDSKYNFAYEVTVLLPDNEALSMTQKFPVHSEYDKDILMEGTCV
SIPLTELNRFLDQDKVLHYRVSVLAVKSPRRAKPPRQNLPQPADLEQAPNGGVNVKSVPT
NMIITRTYKEAIGEVTKADVASPDSEEDPAAADGAGAIGADGAGGVELERKWGTPQLHFN
RKYLRNTLNDATPAEDELRPLAADLRNGNGDDKLSQCSNSTSYTKKVSDSLRRSFRALKA
DIVELRPFSKKAVRDGSTSPVQSNGK
Download sequence
Identical sequences Q9W4W4
7227.FBpp0070458 FBpp0070458 FBpp0070458 NP_570022.2.81976 FBpp0070458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]