SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_570026.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_570026.1.81976
Domain Number 1 Region: 19-76
Classification Level Classification E-value
Superfamily RING/U-box 0.0000459
Family RING finger domain, C3HC4 0.03
Further Details:      
 
Weak hits

Sequence:  NP_570026.1.81976
Domain Number - Region: 93-127
Classification Level Classification E-value
Superfamily CorA soluble domain-like 0.0379
Family CorA soluble domain-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_570026.1.81976
Sequence length 237
Comment vilya [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MAKSQAGQTVEPEASKLWIHCNSCCALFCDKKHTFFLLACHHVFCERCVKVSAGRTPSDA
PIFECSTCRRSVRGRQLTNSMPNHFKQLFHPEPFTIGNDFVETFQRGNHRHFDKYKERKE
LEMDKLFKDIEVAKSVCQKRFLEAQMLRVERKKLMQRSRYIKAEVANRKAEMHRMAQAYR
SRSLTSQSSSSAQRSARGRPRGRGTATQSSSRRRSTESAKRQQITSFIHPPNNSFDL
Download sequence
Identical sequences O76908
FBpp0070464 FBpp0070464 NP_570026.1.81976 7227.FBpp0070464 FBpp0070464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]