SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_571266.1.45394 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_571266.1.45394
Domain Number 1 Region: 81-135
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 4.06e-16
Family Tudor domain 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_571266.1.45394
Sequence length 281
Comment survival motor neuron protein 1 [Danio rerio]; AA=GCF_000002035.6; RF=reference genome; TAX=7955; STAX=7955; NAME=Danio rerio; AL=Chromosome; RT=Major
Sequence
MANGAEDVVFCRGTGQSDDSDIWDDTALIKAYDKAVASFKNALKGEDGATPQENDNPGKK
RKNNKKNKSRKRCNAAPDKEWQVGDSCYAFWSEDGNLYTATITSVDQEKGTCVVFYTDYG
NEEEQNLSDLLTEPPDMDEDALKTANVKETESSTEESDRSFTPQKSGHAKHKSKSNFPMG
PPSWFPSFPPGPPPPPPHFKKMDGRRGEGPGPSFPGWPPMIPLGPPMIPPPPPMSPDFGE
DDEALGSMLISWYMSGYHTGYYMGLRQGRKEAAASKKSHRK
Download sequence
Identical sequences Q9W6S8
NP_571266.1.45394 ENSDARP00000017636 ENSDARP00000017636 7955.ENSDARP00000017636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]