SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_572190.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  NP_572190.1.81976
Domain Number - Region: 16-51
Classification Level Classification E-value
Superfamily TRAF domain-like 0.0785
Family SIAH, seven in absentia homolog 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_572190.1.81976
Sequence length 237
Comment uncharacterized protein Dmel_CG12682 [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MEDRASSIDESIGHSKPAICPLADCQAVVEHTHLLRHMITKHLDPRARTLPFQLRLREVS
TGQRTLLMLPYRQLIIDNDQCLAVLNWSSVSQGDLTAPQLDLPPCHQMLTYHLPILVMVC
RTTWKSLLKQIDEKDMQETRDVTAEWGGVYLFWLLSPLTRRPIYANLALLNSQIQSVYRR
NRRRIRNFASRMPIRQFINGLDPYFVSINEDQLDELCNGGGNRFSIYFEVIIEGVMS
Download sequence
Identical sequences Q9W4G5
NP_572190.1.81976 FBpp0070684 7227.FBpp0070684 FBpp0070684 FBpp0070684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]