SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_572235.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_572235.1.81976
Domain Number 1 Region: 300-440
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.63e-34
Family BCR-homology GTPase activation domain (BH-domain) 0.000021
Further Details:      
 
Domain Number 2 Region: 81-172
Classification Level Classification E-value
Superfamily SH2 domain 5.65e-21
Family SH2 domain 0.00035
Further Details:      
 
Domain Number 3 Region: 233-294
Classification Level Classification E-value
Superfamily Cysteine-rich domain 3.89e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_572235.1.81976
Sequence length 440
Comment Rho GTPase activating protein at 5A, isoform B [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MPRNTEAGAGNANTGGSGGVGGAPEPSSPVQKVWKPELYKLQLEAPAPCPLRCQRTLPLP
PAKSTAEAVEANNLAGRLYGSEYHGLMGHLEAEQLLANARDGSYFVRRSPQSDGYYTLSL
RFNKRPKHYKLLYKPGVGHYLRGQDKRFDTVHDMVADGLINFHMQLHASPIIQQINQQTK
NCYQQSPYMTLNGRKLRALSNELGKAAAKESKESPAEEKEQKQEEPPPPAVDPMPLVYEK
PHHFKVHTFKGLNWCEFCANFLWGFTAQGVKCEACGFVAHSKCSELVPPKCVPDLKRIRG
VFGTDLTTMVQLEPHHQIPFVVRRCVEEVEARGMLQEGIYRVSGFADEIEALKLALDREG
EKTDMSETAYGNVNVIAGTLKLYLRLLPVPLITFQAYPSFMAAGRTGKQAEQRQLMAEAV
RRLPPAHHSCLQYMLEHLKR
Download sequence
Identical sequences Q961S1
NP_572235.1.81976 FBpp0070750 FBpp0070750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]