SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_572663.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_572663.1.81976
Domain Number 1 Region: 455-651,724-1056
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.86e-73
Family RNA helicase 0.086
Further Details:      
 
Domain Number 2 Region: 275-360
Classification Level Classification E-value
Superfamily UBC-like 0.00000000372
Family RWD domain 0.062
Further Details:      
 
Domain Number 3 Region: 249-271
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000772
Family CCCH zinc finger 0.0021
Further Details:      
 
Weak hits

Sequence:  NP_572663.1.81976
Domain Number - Region: 120-160
Classification Level Classification E-value
Superfamily UBA-like 0.000426
Family TS-N domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_572663.1.81976
Sequence length 1288
Comment CG1582, isoform A [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MDESSRKHMEDCFLRSPSDIRTTNVPAAPKSQAADNKSRKTELHVLRLNDESRQMTMDTL
RQIHGPEFQLDDISKYKDRGRGGHGVKHSYWQDRGTLVVQSVQGVSSTRGNDSDGDRLRR
YALAKLENYGFQAVHCLEAYEHCSGDTEAALLLLYRRYMRIPDEEQLTLEPPSEQEILDM
RADEKEALESIFDKAYEEREANRVWNLKFRIDHLLAHSPSEVRKAREAVLAAAAAAAQAA
LDKKKKPPLRCRNFDRDGTCKYGPKCRFAHLPQQPTESDTTKKDSVDENDNELWFHVEVR
FPPGSRYPYEAPFIYLKTTCHDIPHELRLRYARHLYKEAKEICRDGIPCVYSICDLLQSN
EQLAGRLDTSAFPSPKRSLFYDEPAGGGVNPDAEHHQSPKPSHYARGQTSRNDGGHQRNV
EAQTRENRRLLQQFVERRKEERYQKIIDGRKQLPAFAEIERILALIESSPVVVISGETGC
GKSTQVPQFILDNWFFRALQLPAKENLPHVEIICTQPRRLSAIGVAERVAAERLDRIGQL
VGYQIRLENKVSQSTRLSFCTTGILLRRLASDPLLGSVTHVIVDEVHERSEESDFLLLIL
KNLLRERKDLKVILMSATLNAALFSDYFGGAPVLDIPGRTFPVQQLFLEDILEMSDFVME
YDTKYCRKLKKQEQEILERELEYADVQASGEAPGKKIKDEKLTLAETYQRYAEYSKPTCK
SIYLMEPMTINPELIESVLKYIVEGSHDWPREGTILIFLPGFGEIQSVHDSLLDNALFSP
RAGKFILVPLHSALSGEDQALVFKKAPPGKRKIVLSTNIAETSVTIDDCVFVVDCGLMKE
KCFDSNRNMESLDLVWVSRANAKQRKGRAGRVMPGVCIHLYTSYRYQYHILAQPVPEIQR
VPLEQIVLRIKTLQTFASRNTLSVLLETLEAPTEDSVLGALTRLRDVGALDAEDQLTPLG
HHLAALPVDVRIGKLMLYGAIFQCLDSVLTIAACLSNKSPFVSPLNKRTEADKCKRMFAL
GNSDHLTVLNAYRKWLDVARRGNYAASRNYASEHFLSLNTLETIADLKYQYLELLVSIGF
VPIDVPRRRKNACDNILTLTGVEQNHNGDNNRLLTSLLCAALYPNIVKIMTPDRVYIQTA
GGAVPREPSHHDLRFKTRGDGYVKIHPSSVNSQVSVFQAPFLVFQEKVRTSAIYIRDCSM
LPLIAMVLFAGSDFKVELHDGDFLFLLESGWIILKAHDLETAEMVQCLRAEMIKLLEEKI
RDPCLNLLHHKNGCRMIANIVHLISKNS
Download sequence
Identical sequences Q9VZ55
FBpp0073259 7227.FBpp0073259 FBpp0073259 NP_001285098.1.81976 NP_572663.1.81976 FBpp0073259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]