SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_572692.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  NP_572692.1.81976
Domain Number - Region: 543-596
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00055
Family PHD domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_572692.1.81976
Sequence length 602
Comment l(3)mbt interacting protein 1, isoform A [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MSKYHKERKYAKFRYYMEKYYVLPLELKNDIIYCQRSLRDFLKVHALVSEVFDEQADADP
VQMRRILDELEEEVYEINAEQQFLLLRLNDSLQEFSVKLKENNIMFLPDIAHEYVSAQVV
PLIVDPNYKIMPQSVMARDTEEMLIRKHFLLSQDDDSGMPPLKLSELDENIPLMLAPPVR
GLGQQIAAVKPEPEWLQGDEATVSVPPPPPQSKSKLMKGSLDSTPAKRENISRSSPPPLA
PITQTVVAELSQVPPSPQAESPPVNFHVVAQSRKNLQQALRRARKTKQQPRLFDDEEDLE
ITSLQNDRNKNRTSDGKGTPPSLEPTNAAANQAAKKTIPQMSSQGMAKNNTAKSKNTCRK
SSPTPTSSGQSQPAVSSSGSSDDSSAELQQEQQRRVASAAQWRDEPRESRTQPEEYGQET
FLGLFELYSPEVLKKLSQRHSKRKRRTVQNASGVDFHYGQQLNAVDALVMGVRGQKKTKE
KSEFLLSPTEKRLQANSKRTYTRKSKSPDEISEKSSAGGGSGASGTASSSACQHKDGGAS
KCRKCRECRECKRRVETEAMYCHLCSGLYHMDCHEFTKNRQLMQLQNSRCPPCLREKDKL
EK
Download sequence
Identical sequences Q9VZ22
FBpp0073296 FBpp0073296 NP_001285113.1.81976 NP_572692.1.81976 FBpp0073296 7227.FBpp0073296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]