SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_572870.2.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_572870.2.81976
Domain Number 1 Region: 81-188
Classification Level Classification E-value
Superfamily L domain-like 1.79e-24
Family Ngr ectodomain-like 0.011
Further Details:      
 
Domain Number 2 Region: 318-420
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.00000000693
Family Hormone receptor domain 0.0062
Further Details:      
 
Domain Number 3 Region: 226-344
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000359
Family V set domains (antibody variable domain-like) 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_572870.2.81976
Sequence length 1797
Comment uncharacterized protein Dmel_CG15744 [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MPTATATSTAAEGGQAVQVQTHQDTELPQNPETGIATGQGTASSCPRKCSCRSTAENIHS
LKIRCDEQQITNWRELDFGEDVTSIVSINASKNSIALITAEDFRNFTELKRLDLSFNLLT
ELDKDTFGDSLAHLEKLKLAGNAISHIYEGTFDQMPKLKLLDLSGNPLACDCGLIWLIAW
SSSREVRLQPPPKCESPGNFRGMPLKKLRVGKDFHCETLLQPLLELIPSQNQVAFEGDEL
QLKCHAPRVAIGVPRESEDLPTKAYVFWGWSEKIRAKNSTEDIIYQDPTKVFGDVNLETR
HSTDSGILQSILRIASLTQNHTGMWDCTLRSQQANLSQAIVLHVVAKGTLYCEARVVHTN
KGTYHWPRTMRGETVLQECVEEPSDATQARRASHECGPSGEWLNLDTESCVYVSETTRIL
EQFAKVNLTLTKGQNALEIARRLHNFTQAQTQLNRIRDPMDLEYIARTLVKYLDQLEQPQ
QQQEISHLLMDIVSQLLNLPAHLFRAAQSEQGTGQRLLHVVESSAMRLALASTQAEPLPA
EMIPWRGSLAQQRNLFVEFFNISLDAFVSLSCVWLEQSPRGFQCNSANDTIPMYEHGDID
AAIQLPYSVIGNSSTTLPATTTIRSLRLMISLHRNGKLLPNLRGSHNESLSSAIIGILAY
SSDGEALQFRADNELDPEEDVYQQRVTVMLRAHPYHNPLSAPQPAWWDADEQRWETSVCQ
QHYQHRTLVMFSCSRTGYYGLLQRSQYLNDFRSEESGARFRHPPAAVYAGCGLLFACCAF
NAVTFAVFGRAVRINRVQRHALVNTWLALGALALAFSLGIYQTASQPQCRLLGLLMHYLG
LCVLLWVCVSLSSMYKRLTKTTTSGQGQCPGQDMEPQRERERKPILGIYLVGWGIALLIC
GISSAVNLAEYATYDYCFLHSSTTLNALLVPAVILVIFCGILALCIYYQLSQQAVNVLQL
QMQHQQNRQYSDNNTQATEHIDLDWLDANGSATTAAIGGGSGNHGGRKEQDHMQEQYSTL
SNPLSSIVDDFERSNLSHLRGHFIFLVLYAGAWLSAAAYVNGGQELYVLSFAGCCSVLGI
FLLIFYNLSRNDARQAWSQGRDGRSIPAKLVTYNNGSQARGAHPSSMMPGPGTAMISNSI
VAYKANPGPGSLYEANNSAGSRSNSQCSRSMRSQTRSQTRSQQEQLLQANGAGGVTIINN
TSGQPGAGGGPAAGGVSGSTGGAPVPPHSLNALLHGSSHDLIPSAEIFYNPNQINVARKF
FKKQKRLAKRNNFELQRQTMPQMQLQMQMQMQLHSQHSLSDASSEQLYSRHHNAMTMLAG
GSKINNTNLHYKNQGSPMAGAPKEHGNMGAMSSGGDSMQFKRFVPASASSASKIMQANIY
TNIPETLTPQHEVIKLRANGRTRTPSLLDETLHELDDDEEDEEEEEHGQTPATMEEPEHE
LEEEDASSLDEHAPLYANTLPPASGMSSLFRNRGSSHQPMSSTPVKQPSLEAMNSLGLPE
VSLEEPLLQKHEIYVSNSLQVTTSNSIQLDDDFPSVLIRFSQQQQSKSLNNISEMLAGGG
GGGGNAPGLDSLGDQQESSQLSVNEGSTLEEQQLRQIYSCSSSNLSQLKGHHPTATVDTE
DDGRLLSGSPTNESDLNYQNSEISIRSHGLYAPQADNDLNLTLTDDFRCYQSSNASDADV
DVLNEFDDEFVAATGGERVVGDAEQDPHHDHDQDTSIDELYEAIKCRSPLRNKQEAVERF
ERERERDREKEMEMEAKPLSNSHNENLNETIEDDSSQSSVISYIDPRAANEPRPFPS
Download sequence
Identical sequences Q7KV24
7227.FBpp0073587 FBpp0073587 NP_572870.2.81976 FBpp0073587 FBpp0073587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]