SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_587806.1.19918 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_587806.1.19918
Domain Number 1 Region: 174-271
Classification Level Classification E-value
Superfamily Homeodomain-like 2.15e-22
Family SWIRM domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_587806.1.19918
Sequence length 272
Comment Clr6 associated factor 2, Laf2 [Schizosaccharomyces pombe 972h-]; AA=GCF_000002945.1; RF=representative genome; TAX=4896; STAX=4896; NAME=Schizosaccharomyces pombe; strain=972h-; AL=Chromosome; RT=Major
Sequence
MQILKDQENLNPDGGSFVLITPPLSPPKQKSLSYTNISRRHGMRACMKGIVYEVYKNQPK
LWLQQELIWLRRKRIHPIPKARRNNHVGRWANRHSNVSSSSGSRGRSSVSSRDSSPSYSG
ALRSAERSISSSPSTIEARRRKSARGNGLNGAIDVANLPFEELPNFCPDMSVLDNRTHPR
TLKAEWKGPPLDLSDDPYRDLLHPAELHLASTLRLPCLIYLDNKKRIFAEWHHRRQQGLT
FRKTDAQRASRVDVNKASRLWKAFHEVGFFDD
Download sequence
Identical sequences O74443
NP_587806.1.19918 SPCC1682_13.1 4896.SPCC1682.13-1 SPCC1682.13

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]