SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_592937.1.19918 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_592937.1.19918
Domain Number 1 Region: 505-565,603-875,997-1037
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.05e-34
Family FAD-linked reductases, N-terminal domain 0.023
Further Details:      
 
Domain Number 2 Region: 392-486
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000000349
Family SWIRM domain 0.028
Further Details:      
 
Domain Number 3 Region: 1109-1203
Classification Level Classification E-value
Superfamily HMG-box 0.00000012
Family HMG-box 0.0047
Further Details:      
 
Weak hits

Sequence:  NP_592937.1.19918
Domain Number - Region: 861-970
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.000204
Family L-aminoacid/polyamine oxidase 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_592937.1.19918
Sequence length 1273
Comment histone demethylase SWIRM2 (predicted) [Schizosaccharomyces pombe 972h-]; AA=GCF_000002945.1; RF=representative genome; TAX=4896; STAX=4896; NAME=Schizosaccharomyces pombe; strain=972h-; AL=Chromosome; RT=Major
Sequence
MPLGRSSWICCAKYFVNTKSRFNEILPPRFTLIVSFYSMNTSENDPDGHYDFPEMTEHHS
DRASSYANANNVNSTQPQLVSSEQALLAILGGGLQSITPNSVNQNAYSRSTYRTDGGLNS
QPVSSLNNQWGNYNPAFLPSRYDSSFHPYTISQAANQPFPQHLLGNSNAGVAQQSGMRTI
GLPPTVGSSFPQQKSSTYENFFDANSPSSQQFPSTYPSRSQNPLSSSGDGSTAIHAGPIQ
HQNSNAFSNYPYPLDASHLSSQQLLSMYRDQVSHGVTPSTFRNHESFMPTQLVSATELSK
SVDNAVLPIPPTTAPAVVSPPASSFPLMSSAATSGNISSPALFDSELGARPEGSVAIEPS
RVLLQWSSQSSSHTIPSAGASIPTSSLKSFFEHAAEAARKCNLDPRALESFEQHMLSDRL
HDPVVLFHYFQIRNSICWLWIKNPTHAISRVEAQGVCVDRCLFQLASLAYEFLVRYGYIN
YGCLSFDSSFTNETNTGTTSSSASKQKTIAVVGAGLTGLICARQLTGLFSQYSSSFLSKN
ELPPKVIILEAKERTGGRIYSRALPVSHTSATQINHHTSNSNSISSNSTSLNPKDVTDPS
HIPSAIDLGFQFLFSPMDDILLNLLNKQLGIEVTEMTGSDLVYDETDTKVLDMVEVKKLN
ILWEKLLEYVSVCFFINVEESVRISWISQFQLFIDEMFPDHLSKSLSLNASHEFSFKKTM
LILIDEVSSYAKLGNSQKKFLIWCFKVAELDDTLYPLNTVDTDFSKDILIPKVARRGLSQ
LPWALQSYPSPLNIHYEKFVSKVTIENDKCTLDCKDNSSYEVDQVVIACSPSHFSSNIEF
SPGLPNFVTENIKSIDFKPGKKVILRYAAAFWRKNIRSFGIIPKSLSQEMNNDENDGKSC
FVLRIWNMLPETGVPILVADINPQMTSSSSNETSHLIQELHSLIVDHFQNDSNSSADLLD
AWVTNWSRNGVYDGLNSYPNFANDKQQYEKRFRQSQLSYNLGRLHIAGDYIFSCVGCRTL
QRSFLSGLSVCTGIIDSLAPISLTIPIIGETSRKELDQFLRNSKVNNFDPNAEAQRHLSY
QARYRLKKQERLDEHKEEQEQLVTELLGYLPEPPSKPNANPFLLYQKMQWHVCRALADED
KRRLTGDSTAKATINETRAKLGKTWRQLDDLGKKPWIDEIAAQREAYAGKILRYQRLTKE
YEMRAEQIRNDYAAKCQDEPIPDDEARLFMQAQREEEQRKQTQDDNISKSREASDEEYHD
DGSSDSGYNGTRY
Download sequence
Identical sequences Q10135
SPAC23E2_02.1 SPAC23E2.02 NP_592937.1.19918 4896.SPAC23E2.02-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]