SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_594257.1.19918 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_594257.1.19918
Domain Number 1 Region: 48-154
Classification Level Classification E-value
Superfamily Homeodomain-like 1.25e-32
Family SWIRM domain 0.00011
Further Details:      
 
Domain Number 2 Region: 291-335
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000445
Family Homeodomain 0.067
Further Details:      
 
Weak hits

Sequence:  NP_594257.1.19918
Domain Number - Region: 220-267
Classification Level Classification E-value
Superfamily RING/U-box 0.0494
Family ZZ domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_594257.1.19918
Sequence length 527
Comment SWI/SNF and RSC complex subunit Ssr1 [Schizosaccharomyces pombe 972h-]; AA=GCF_000002945.1; RF=representative genome; TAX=4896; STAX=4896; NAME=Schizosaccharomyces pombe; strain=972h-; AL=Chromosome; RT=Major
Sequence
MSNVTENKHDLHENGVPDSAQPMELDVSKKEDTEPEVRDEAKEFLLSQLPQVEVPEWAQW
FDFSKVHEIEKKQNPEFFDGKNTSKTPEVYKEYRDFMISTFRLNSKVYLTFTACRRNLAG
DVCAVLRVHRFLEQWGLINYNVNPDTRPSKIGPPSTSHFQILADTPRGLVPLLPPPSSSI
PRSKAVTIEDPSIVRTNIYDPSLDDVLKGKGSTPNQKPSLSNLHENNIDQSDSPQHCYCC
GNKFNESYYQSQTAQKYNVCISCYQQNRFPSPTTIADYKEVAIQNKIEDDDTWTAQELVL
LSEGVEMYSDDWAKVASHVNTKSVEECILKFLNLPSSDKALFKMDKVHTNPVVDSLQGKN
PILSVVSFLAKMVPPSSFTQKSSAKEEESDKVKGESVYPKPESESYDVEMNGKSLEDSDS
LSELYLTNEEKKMASIIKDSVNVQIKLIESKLSHFDYLDQHIRLKSQELDAFAQATYREK
LYMKRECQNARKKIEQQLQSKDTAANGLPVQSSAETSVIPASSMSPS
Download sequence
Identical sequences O13788
NP_594257.1.19918 4896.SPAC17G6.10-1 SPAC17G6_10.1 SPAC17G6.10

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]