SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_598417.2.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_598417.2.92730
Domain Number 1 Region: 10-120,161-187
Classification Level Classification E-value
Superfamily SH2 domain 2.29e-26
Family SH2 domain 0.0000024
Further Details:      
 
Domain Number 2 Region: 61-79,135-227
Classification Level Classification E-value
Superfamily SH3-domain 4e-25
Family SH3-domain 0.0000291
Further Details:      
 
Domain Number 3 Region: 209-300
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000144
Family SH3-domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_598417.2.92730
Sequence length 304
Comment adapter molecule crk isoform 2 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MAGNFDSEERSSWYWGRLSRQEAVALLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHY
IINSSGPRPPVPPSPAQPPPGVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVAR
SRQGSGVILRQEEAEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRG
MIPVPYVEKYRPASASVSALIGGNQEGSHPQPLGGPEPGPYAQPSVNTPLPNLQNGPIYA
RVIQKRVPNAYDKTALALEVGELVKVTKINVSGQWEGECNGKRGHFPFTHVRLLDQQNPD
EDFS
Download sequence
Identical sequences Q5ND51 Q64010
ENSMUSP00000017920 ENSMUSP00000017920 NP_598417.2.92730 mmt008000518.1 ENSMUSP00000017920 10090.ENSMUSP00000017920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]