SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_599197.2.100692 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_599197.2.100692
Domain Number 1 Region: 541-711
Classification Level Classification E-value
Superfamily Sec7 domain 1.96e-55
Family Sec7 domain 0.0000442
Further Details:      
 
Domain Number 2 Region: 749-870
Classification Level Classification E-value
Superfamily PH domain-like 2.28e-26
Family Pleckstrin-homology domain (PH domain) 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_599197.2.100692
Sequence length 1023
Comment PH and SEC7 domain-containing protein 1 [Rattus norvegicus]; AA=GCF_000001895.5; RF=representative genome; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=mixed; AL=Chromosome; RT=Major
Sequence
MAQGAMRFCSEGDCAISPPRCPRRWLPEGPVPQSPPASMYGSTGSLIRRVVGPGPRGRDL
GRVTAPCTPLRAPPSPHIAPSPWGPSSPTGKPPPGAQSSVVIFRFVEKASVRPLNGLPAS
GGLSRSWDLGGISPSRPTPALGPGCNRKLRLEASTSDPLPAGGGSVLPGSRDPSRGPLIP
PQIGADGLYSSLPNGLGGTPEHLVMHFRGPADTGFLNQGDTWSSREVSSHAQRIARAKWE
FFYGSLDPPSSGAKPPEQALPSHGVGSKQGSGVAVGRAAKYSETDLDKVPLRCYRETDID
EVLAEREEADSAIESQPSSEGPPGTTQPPASRPSPCPGPSSSLGSGNGDDEAGGEEDVDD
EVFEASEGARPGDHMPHSGLLKSPVPFLPGTSPSADGPDSFSCMFEAIMESHRAKGTSYS
SLASLEALASPGPTQSPFFTFEMPPQPPAPRPDPPAPAPLAPLEPDSGTSSVADGPWTQR
REVEESDAGATLAPRKELPSPSHSEDSLGLGAAPLGSEPPLSQLVSDSDSELDSTERLAL
GSTDTLSNGQKADLEAAQRLAKRLYRLDGFRKADVARHLGKNNDFSKLVAGEYLKFFVFT
GMTLDQALRVFLKELALMGETQERERVLAHFSQRYFQCNPEALSSEDGAHTLTCALMLLN
TDLHGHNIGKRMTCGDFIGNLEGLNDGGDFPRELLKALYSSIKNEKLQWAIDEEELRRSL
SELADPNPKVIKRVSGGSGSSSSPFLDLTPEPGAAVYKHGALVRKVHADPDCRKTPRGKR
GWKSFHGILKGMILYLQKEEYQPGKALSEAELKNAISIHHALATRASDYSKRPHVFYLRT
ADWRVFLFQAPSLEQMQSWITRINVVAAMFSAPPFPAAVSSQKKFSRPLLPSAATRLSQE
EQVRTHEAKLKAMASELREHRAAHLGKKARGKEAEEQRQKETYLEFEKSRYGTYAALLRV
KMKAASEELDAIEAALAQAGSTEEGCPPPHSSPSLQPNPTSQPRAQRPGSEARAGAGSTR
PKP
Download sequence
Identical sequences G3V8J5
10116.ENSRNOP00000026378 ENSRNOP00000026378 ENSRNOP00000051585 NP_599197.2.100692 NP_599197.2.4139 XP_006231494.1.100692 XP_008758616.1.100692 XP_008758618.1.100692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]