SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_608553.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_608553.1.81976
Domain Number 1 Region: 8-143
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.89e-22
Family Galectin (animal S-lectin) 0.0058
Further Details:      
 
Domain Number 2 Region: 163-286
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.31e-17
Family Galectin (animal S-lectin) 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_608553.1.81976
Sequence length 316
Comment uncharacterized protein Dmel_CG13950, isoform A [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MNVWKAKVLTEVPFGHVLIVSGRVKPHPNKISLDLTDNVNAQNESETVFLKIEANFREGQ
IIRSMFQPGGGWQQEEISKNWKCDGPKNPLQPGQSFTFRVAVLQRCFEIYVNDQLYGSFE
FVKFPKQINYVRTYGDFEKITQFHHRMLFPLVFPRTLMCPDKVAFQSDVPRRYETGTVVA
MECIAKGPPTTEFSICFQCNDTGRTVLRFHVNFDRTTVSRSYQREDNSFALSDEETEGEF
PFVRGKLFKIAFGLGDRAFLIAVNGQYFTYYNFPGRPFSISTLKCFTNEVGDFAVRSLEY
HSDSPLLARVEKLSII
Download sequence
Identical sequences Q9VPU6
NP_001334728.1.81976 NP_608553.1.81976 FBpp0077683 7227.FBpp0077683 FBpp0077683 FBpp0077683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]