SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_608725.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_608725.1.81976
Domain Number 1 Region: 389-447
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000003
Family Variant RING domain 0.0081
Further Details:      
 
Weak hits

Sequence:  NP_608725.1.81976
Domain Number - Region: 46-75
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000858
Family EGF-type module 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_608725.1.81976
Sequence length 562
Comment CG2991, isoform B [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MLPSLDTLMRCSKRVLQSPLEAAASQMRNGHSKSAAGGIYGPFTPDNDLSCSGRGDCVNN
TCVCDIRYAGNECDIFNLPYYAGISTVFYVVALVSVIQLLICIVAEYQRLKQPSVLRACR
ITTQKLLYFMVFVAASLRGAYFTTPLDLQPQWAVTLMSAYYPLLMTCASLIVCMWAEIFH
LRDIRWEKSQFLSKSFLGFVAFNFFLYSLFGIEVFNSLINAERRDYAHIFNGCYAVLLLI
VVVFFLIYGVEVFFKLRGGFVYDQTGKILGPSEAIVNASQLHQSRFGLLFQAVMLIVIVG
FLTSETLGDFWKTKVPVNSRNWHDIIFRIAEIGVALWFPCCLWNSMAPEQLWILNPRKLL
SRQIDPSIPTLNAETNKLSPEEGQSFLTKKDCWICYDSDKPEPLIQPCRCTGDVSSVHHE
CLKRWLVESCSNSEAQLSCKVCGHPYEIEKSKKLEWDKGFTIQHWSKTVILITLMCVTGA
TAWVVIQMYVDPLVRVMTVGIAVLIGYVCVKCLGENTVVAYQRAKVSSINIVTSSEMEKL
HTICEEVSASTSAEAVRAGAAS
Download sequence
Identical sequences B4Q8M2 Q9VQI2
FBpp0077310 FBpp0077311 FBpp0077312 FBpp0077310 FBpp0077311 FBpp0077312 NP_608725.1.81976 NP_722856.1.81976 NP_722857.1.81976 XP_016023199.1.80810 XP_016023200.1.80810 XP_016023201.1.80810 7227.FBpp0077310 FBpp0221591 FBpp0077310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]