SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_609115.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_609115.1.81976
Domain Number 1 Region: 3-115
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.02e-32
Family Single strand DNA-binding domain, SSB 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_609115.1.81976
Sequence length 204
Comment CG5181 [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MYNVECIPIKDIKPGLKNINVIFIVLEVGVATVTKENREVRNFKVGDPTACINVSIWDEP
GKLIAPGDIVRLTKGYASIWRHCLTLYSGKNGEVFKIGEYCMVFNESVNMSEPKRAEQQA
VANPAATPAGLPAGGGAPGLPAKGGATGIPQPAVAAAPGAPATQSAVTTAPAAAPAIAPQ
TTTKPGTRGGRGGGGRGGLKGERR
Download sequence
Identical sequences Q9VM17
FBpp0079091 7227.FBpp0079091 FBpp0079091 FBpp0079091 NP_609115.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]