SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_609130.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_609130.1.81976
Domain Number 1 Region: 313-425
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 6.54e-16
Family Frizzled cysteine-rich domain 0.0012
Further Details:      
 
Domain Number 2 Region: 697-735
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000969
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 3 Region: 431-465
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000432
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 4 Region: 468-505
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000484
Family LDL receptor-like module 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_609130.1.81976
Sequence length 787
Comment CG6739, isoform A [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MAEQKQLEAIANETSSVTGLRRQPTKYPHGLNITVQTIDDDNEGSPKDHSDYTRASGDSC
WSKTQKYHIGMLGSPETLAELQVRRYKYPLTANYYLNSKLERPEKPTPWMLLGYARSVCR
WKYLRWPIIFVASVLLFFGLITYCLWLHDVSVARAKFLQRRYEATLTSTSSSSNEVWDEE
TTSSTERSPQETTRLEDMDDSDESTELPEIAFGDDGDPEAGGEDGDGDYDDTLLPADSIR
FTSGHQNSFGVPIEQDKRMLQLLKELLHKPQATPAGNEPTLTRVSPTLPPPLSASGRPTE
AMALTTPSTTNSGCQSTMLPMCQGVLDYDLTFNREGAAPRDAVSMAAYDSLIRANCSVRA
AEFICGALEPECRPLHIGQLPPCRRICKAILEACSIPIYNSDVLGELFDCNLYPDAHESH
KCEDPTRRRDYCYGNEFQCHDGSCIPQNWQCDKIKDCQGGEDEDEQCLVCEPDEFRCRSN
EKCLVEKYRCDQNIDCMDGSDEQDCDEYGSGDLAPFDESELNAFPRVFTYASFLSPNETN
DKVYTYITATTDEDAGTETKFQIHQVAAPAPPVNSSAEEGAGGPKGFVNFRDSKEIMMTS
DSETKFKYSQRANRTSVKFSVSAPTTPAARTSSAIPSSALVQQRERTTSTTTTSTTTSTT
TSSITSTPSITSTTLIPINAATSEPNPYEVVTSLGGCPPQELRCVSGKCITVSQLCDKQI
DCPDAADELMCVYRERPSRRRLTSTTAPPTTSSAPPETSTATTTTGPLSSTRRSLRTTPN
RSRKPKS
Download sequence
Identical sequences Q9VLZ6
FBpp0079096 FBpp0079096 FBpp0079096 NP_609130.1.81976 7227.FBpp0079096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]