SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_609208.2.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  NP_609208.2.81976
Domain Number - Region: 502-598
Classification Level Classification E-value
Superfamily Bromodomain 0.000994
Family Bromodomain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_609208.2.81976
Sequence length 649
Comment mitoshell, isoform D [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MNIPIYQVPSVTMQSLHQQSLYQQTYLDRNRMVTDVFVQEHVSQSSWSMAGSSAVFIPGP
IITGSAHGHCHHTATVSTVSPQLATFMPFPGMQYYAASSATMNAYGHNQMYSTRASASVG
FYLPQYHASCSHEQPKKTFCAAQTQTQQTAKTSCDVGTQVDLDAEELRSEARKPRPESVV
PEESSISSLESGAGDGFRVQKKLRNSEVKLLDQRLHDITRVSLHGSEIAERLANAHRNRP
CFKKIDTLCARLKQDLLRPDGVLPNINSQGIAWAVKDFIFVFTRIVNAWVILKGYVYNTP
DALNKIKDELPSGFMASFDSWQISTLSIVKMIVKSFVNLDELLQKQKNSFSGKDGAPINQ
SNSISLRSFIDSNDSSGLAQKYLGMTTGHGPSAFSTPNNQIRNNAASKGQEPTSSALYKP
KCALNLNYLYTMIEDSEETQRHVDANGTYLKTGTYQPLQKESMQLEMPPAKPNDHYVERN
ANQQALPSQEIPNAPTPKSSPQSDRPRDVRSYTNPFSAIGKEVTRQLYEFSDRVMELKNL
ERFFKKQFTRNYYPNFYQHCQDDFIDVRAIILRCENSSYHHIYQAIHDLRRIIFTVRCYL
QMYTDENLLYYIDLYERSVNDMLSKPPHYPNQFDHIMGRPGEKLFNYEI
Download sequence
Identical sequences Q9VLP4
FBpp0290393 NP_609208.2.81976 FBpp0290393 FBpp0290393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]