SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_609320.2.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_609320.2.81976
Domain Number 1 Region: 521-594,644-810
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2e-59
Family Tandem AAA-ATPase domain 0.00012
Further Details:      
 
Domain Number 2 Region: 265-519
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.51e-53
Family Tandem AAA-ATPase domain 0.0001
Further Details:      
 
Weak hits

Sequence:  NP_609320.2.81976
Domain Number - Region: 182-227
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.000545
Family ComEA-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_609320.2.81976
Sequence length 844
Comment Etl1 [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MSDSTVAASASASASSSAKSSLSDLRQFRINKNASSVVASPSRTERVPGKKRIQVMADSD
SDGNDSQTPKKTKLELTVKEKEERYMAAAKISPHFDTMAIQESLSRTNWDVAASVRYLRE
NCKPKGHNGPLAKSKLKPRSNGISGGNFSDNDHSDDDDVKQSKDQVYDSDDSDSEMSTKM
TGQRKKVFQFMNEASLIELQSVKTLSEKKALAIIDVRPFSDWSDLRQKLESIRMSGDLLN
YAQELINKQNTVAAILSKCNNMVSRLEKAISNGAGIVEQPKLLSSGLQLADYQIIGLNWL
TVMHKQEMNGILADEMGLGKTIQVIAFLAYLKENGLSQAAHLIVVPSSTLDNWEAEISRW
CPELVVEKYHGSQDERRRMRGRFAKDGFTGFDVLLTTYHIVGSTPEERKMFRVCKLDYVI
FDEAHMLKNMTTQRYANLITINARMRILLTGTPLQNNLLELISLLCFVMPKFFAKSIEDI
KSLFAKKGKSDGDQDEVSQFQETQIQRAKRIMKPFVLRRLKKDVLKNLPKKLSLVEKVPM
SSQQKIYYHELVDYYSNNKGEVCSSSERAGIAIMMEMRRIANHPLLMRHYFTDANLRGFS
KRLANASSFKKTNEQYIFEELAVMSDFQVYQMMNKHEFYDVKIPDNLICDSGKFLYLDTL
LPKLKAEGHRVLLFSQFTMMLDIVEEYLRIRKFGFCRLDGATAVNVRQDLITDFNGDDSI
FVFLLSTKAGGVGINLTAADTCVIHDIDFNPYNDKQAEDRCHRMGQQRPVTIYRLISEST
IEEGILMAAEEKLKLEKDITSNEKGEVHEQRCVVKLLTTALGLDKDQEEQLNNSLNNSIA
SPAK
Download sequence
Identical sequences Q9VL72
FBpp0099672 FBpp0079496 FBpp0079496 NP_609320.2.81976 7227.FBpp0079496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]