SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_609610.2.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_609610.2.81976
Domain Number 1 Region: 191-573
Classification Level Classification E-value
Superfamily L domain-like 3.95e-58
Family Ngr ectodomain-like 0.0062
Further Details:      
 
Domain Number 2 Region: 634-680,716-768
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000504
Family I set domains 0.066
Further Details:      
 
Weak hits

Sequence:  NP_609610.2.81976
Domain Number - Region: 835-956
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0144
Family Apolipoprotein A-I 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_609610.2.81976
Sequence length 1257
Comment uncharacterized protein Dmel_CG16974, isoform A [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MEAISKISLILCALFVGLKAAAAISGDSTHCLATYSSAEAYLAQIPQQHRPQIRPRIRTW
QEHEFSLLGYKFHLPFVGHAVDSDLDDSDSDEGLWLDAADAGSESVEVEEHELPSVGHVD
PTGNVFKLNCEHVDLRRVNQELLSQRSSHINYNQLMLAHVPADRSNPLKLPQLESLREFS
WQSSELKDETLMELFTRQPRSFEYMERLNLAENRLECLHWAIPLAVRRVKVLEMSGNRLS
NCSLLNLQYMKQLQELHLDRSELTYLPQRFLGELSELRMLNLSQNLLTELPRDIFVGALK
LERLYLSGNRLSVLPFMLFQTAADLQVLDLSDNRLLSFPDNFFARNGQLRQLHLQRNQLK
SIGKHSLYSLRELRQLDLSQNSLSVIDRKAFESLDHLLALNVSGNNLTLLSSIIFQSLHA
LRQLDLSRNQFKQLPSGLFQRQRSLVLLRIDETPIEQFSNWISRYDESLVDPQVLHRLRY
LSVQQNRKLTYLPATLFANTPNIRELLLAENGLLQLPTQISGLSRLQRLSVRGNSLGSLP
ENIKELRQLHYLNILGNEYQCDCSMYWLTAWLANTSTSLRHQMPQAQNHSNGSTNQTPLD
SYESIDHQIDALKCQYGYRGDMLRVLSKLNCSVPTVVQFSEPKMHKLLSTAKLECQISGS
PVPDIIWVTPRNKILRHHADPDKRPIIIDSKEDAHQPPSAQELAALMDESYIQSLNWTRQ
NSLVGRRVVLVENGSLLVHNISRIDSGLYTCYAFNVMGKASAGLRLYIDPIVFYRVKIGS
ILFGTALATAFLLLTLIVQGLRSCLSRWGICNRFYCCVNRKKKSPRKHQIYAMLDSIETY
KSQQLERLRENYTQQVHRIRENCAQQVEWIQSSYTSQAKHIREFRDIGSNHLTTLKDQYY
DQVKKVRDYSTGQLSWVRENYVFQRNKIRKFSAHQVLRLREGYKYQQQTLNKVLENLPSF
YFENCRGRCEEDIAEDIDCYFKGQMDFGDSKELHIQKIKARLSANYSASKASLYYTPPDD
DLLHSSQLNLQNSPIHINYIDENLDQQKQLEHDFKMEPQLLLYNASMLYMNPEGASSSGQ
AAALAAAGALSQFISVEDNNQEQEMQPLRKISGKPLGMPELKDLNDVKTSKSCPAIYKVS
KQRDGSTLHELQKEGEAPYQMLRINPVETTSLTSTVAPVMQARTEKLNIILDECGTASLC
KAEQEGDAGNSETPPSESSCESNSLAASCGDVCQVSSKLANDASLPSTPPKPDHAST
Download sequence
Identical sequences Q9VK28
NP_001246018.1.81976 NP_609610.2.81976 FBpp0080067 FBpp0080067 FBpp0294006 7227.FBpp0080067 FBpp0080067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]