SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_609806.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_609806.1.81976
Domain Number 1 Region: 213-515
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 1.72e-38
Family NodB-like polysaccharide deacetylase 0.014
Further Details:      
 
Domain Number 2 Region: 108-157
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000023
Family Tachycitin 0.027
Further Details:      
 
Domain Number 3 Region: 169-202
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000694
Family LDL receptor-like module 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_609806.1.81976
Sequence length 577
Comment ChLD3 [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MLCPGENAYNANGQTGFTVKVVASAQRRSKPQPTARIPNAHRLPSLCIWMMVALMIMSSS
LDALVIDNDGIVGNQTRHRRSTSGAASCMQDARFYRNPNRPVHKIWTNSECAKYFLCLDG
EVFEFKCSEGLLFDVVRQICDFKANVDNCDVSAETPAPKPLLEMADCADEYQLGCADGTC
LPQEYFCDGSVDCPDGSDEGWCDVEHDPNAAGACDPRKCHLPQCFCSKDGTQIPGSLPAQ
SVPQMILLTFDDAINHDNWELFSKVLFTQHRRNPNGCPIKGTFYVSHPFTNYQYVQKLWN
DGHEIAVHSVTHRGPEMWWSKNATIEDWFDEMVGQANIINKFAAVRMEEIRGMRVPFLRV
GWNRQFLMMKEFGFVYDSSMVAPHSNPPLWPYTLDYKMPHSCTGVNQNCPSRSYPGIWEL
VMNQLEVGEYMCGMVDTCPPHLSGEDVYRMLTHNFKRHYLSNRAPFGLYFHSTWFKKVDY
LNAFLKFLDDLQKLPDVFFVTNQQAIQWMRHPTPSNQLHQFESWHCQPKDLDPHEQVCNT
PNVCKVRSRVLQEDRFFYTCMECPAQYPWIRNEFGLD
Download sequence
Identical sequences Q9VJI8
FBpp0080449 NP_609806.1.81976 FBpp0080449 FBpp0080449 7227.FBpp0080449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]