SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_610483.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_610483.1.81976
Domain Number 1 Region: 33-181
Classification Level Classification E-value
Superfamily L domain-like 2.52e-33
Family Internalin LRR domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_610483.1.81976
Sequence length 188
Comment CG8800 [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MSKATTIKEALKRWEEREQQNSLTAKVIDLQFQWPPIEKMDSTLGTLVQCERISMSTNMI
EKIFGLSGMKCLKVLSLSRNYIKQISGLEAVAETLEELWLSYNLIEKIKGLTGLKCLKVL
YISNNLIKDWSEFNRLAEIESLEDLVVVGNPLSEGLDEPTWRAECIKRLPTIRKLDGEPV
VLNEEPQL
Download sequence
Identical sequences A1Z7U2 B3N7H4 B4HSR7 B4P414 B4QH84
FBpp0208481 FBpp0087638 7227.FBpp0087638 7245.FBpp0267345 FBpp0087638 FBpp0267345 NP_610483.1.81976 XP_001970320.1.56816 XP_002033081.1.34323 XP_002089785.1.41174 XP_016026674.1.80810 FBpp0202083 FBpp0087638 FBpp0129106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]