SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_610500.2.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_610500.2.81976
Domain Number 1 Region: 224-261,468-546
Classification Level Classification E-value
Superfamily SET domain 9.94e-18
Family Viral histone H3 Lysine 27 Methyltransferase 0.057
Further Details:      
 
Domain Number 2 Region: 256-303
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.0000000209
Family MYND zinc finger 0.09
Further Details:      
 
Domain Number 3 Region: 66-165
Classification Level Classification E-value
Superfamily TPR-like 0.000038
Family Tetratricopeptide repeat (TPR) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_610500.2.81976
Sequence length 751
Comment SET and MYND domain containing, class 4, member 1, isoform C [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MERLARTFSQQNELITLNENYKDEFETFKSLASMPADILQIFQKLALDLLQDLEQPVDRK
GCAERSKNLREEGNLMFKESASGSSKDSVLKACRLYSEAVFEAENAVEELSLAFANRGIA
LQEYGYYREAYDDCSNALECGYPERLRHKVIMRQAFCAWKLKKIASLEEHLDYLGQLQLK
ESFEQQLEDLKQKLELLKNQPREQETQGKVVDKSLGEILTDPGPRGRYMVAKEAISKGNV
IFSERASCFVPLEQLLICQQCAATLMSAPIPCPNCHQRVVYCSRKCREAHSAIHKFECAA
YRKDILRLLGISHLALRLLLTYIPYIRPHLQEMTSAKGMWEEIMNLSRKPEESENAPEYL
RSLRMVSQLDQAIDEELNYHILCANLLQLYLKEHTDFYDQFHSLPASIEDWQLIISALIL
RFAGQLLANGHVGDALLGVGMEPKEFVMLQPELWQKPRHLKRGQLHNLSHSDPITAINLP
YLSLCNHACEPSIRTKFDGCSVVNYAAKDILEGEEIFNCYTMDYRNSLKLQRSHPLKAIY
KFECTCAKCTRTDPDQNYLSFHRYRCEKPNCRQEFLPDAKVQQNNLRWWLRCNAEKPITC
TVCHELQHFAWYNEFLGLIGSSADSSKRQALFKAFDDLDKWLVDHHSLKRIMAEELVTAC
FYEIDGGTSLDEFEYEDLARIIRKQLEGIAAQCGDNSTEYIARMTYLWDIIAQKKCRTDR
KELLEMKGKVDYLASEHREVFLNYYNDFIEQ
Download sequence
Identical sequences A1Z7W1
FBpp0087625 NP_610500.2.81976 NP_724802.1.81976 7227.FBpp0087625 FBpp0087625 FBpp0087625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]