SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_610865.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_610865.1.81976
Domain Number 1 Region: 246-387
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000153
Family Spermadhesin, CUB domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_610865.1.81976
Sequence length 392
Comment uncharacterized protein Dmel_CG17047, isoform A [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MIGYTLLFPLGLLAIAQAQTLNDTASGALAVAQEPGMWRQARRRSVLADSCVTNSGTTGT
CLTRFKCMRQSGTVNGYCGTYGVCCETNLQVGSSTRQKRTIIKNPGVLSSDLNTYTIEAF
SSNVQQLRIDFEQFVMQQPTDVDGVLECQDYFEAGGFKLCGVNDGQHLYLPFNAAAGVDQ
VTLTFVVTSRGTAPVWRLIVTQLEGPPANSRRRSSTSTGLGTSTNSLQDLRDIFASHHAD
YELLAPPGCQQYYTDLSGTIRSFNFQTSVTSNYMPDLSYNICIRSATSASMIEYSFSKFS
MSVQSDSGEGYDEFCHATVHTTGRQEDYLMIPQSILAKNMAYQPTYYCGTNDNLLVYASP
PYMMHFSSDDLTLNRDVETGFSMTYRQRNSLL
Download sequence
Identical sequences A1Z9B9
FBpp0086866 7227.FBpp0086866 NP_001286385.1.81976 NP_610865.1.81976 FBpp0086866 FBpp0086866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]