SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_611377.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_611377.1.81976
Domain Number 1 Region: 301-498
Classification Level Classification E-value
Superfamily Kelch motif 3.73e-56
Family Kelch motif 0.0000195
Further Details:      
 
Domain Number 2 Region: 2-63
Classification Level Classification E-value
Superfamily POZ domain 0.0000000000045
Family BTB/POZ domain 0.01
Further Details:      
 
Weak hits

Sequence:  NP_611377.1.81976
Domain Number - Region: 226-341
Classification Level Classification E-value
Superfamily NHL repeat 0.000222
Family NHL repeat 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_611377.1.81976
Sequence length 513
Comment uncharacterized protein Dmel_CG15097, isoform A [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MLERTQGLVRLHDVDSSALRQLIDYTYTGEITITEQNVQVLLPASGLLQMHSVRDACCKF
LLRQLHPSNCLGIRSFADAHSCKELHTRSHKYALQNFQQVVGTEEFLLLPFEEVRELISN
SQLNISSEERVFAAVINWVKHDLPTRRLHIAELMSNVRLPLVSRDFLMSCVETETLMRDD
SECKELLLEAMKYHLLPEQRSIMGSQRTQERRPEGMKPYVFAVGGGSLFAIHNECEVYNP
RSNSWSPVAPMLWRRSRSGVTSLHKQLYVVGGYDGVSDLATAESYNPLTNKWSNITPMGT
KRSCLGICSYDALIYVCGGYDGASCLSSMERYDPLTGIWSSCPAMSTRRRYCRLAVLENC
IYSLGGFDSTNYQSSVERFDPRVGRWQPVPSMSARRSSCGVASTDGHLYCIGGNDGTMCM
SSGERFSLRRNSWEPIAAMHSRRSTHEVVEVEGALFALGGNDGSSSLNSVERYDTRLNKW
SVVNAMVARRSSVGAAVLECFHLERGLVQTTNL
Download sequence
Identical sequences Q7K2Q6
FBpp0085812 FBpp0085812 NP_611377.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]