SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_611388.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_611388.1.81976
Domain Number 1 Region: 95-148
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000115
Family RING finger domain, C3HC4 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_611388.1.81976
Sequence length 1038
Comment topoisomerase I-interacting protein, isoform A [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MAEENPGALAANVPYLGVDELGASVIVEPGLEGSNAGGRTLPAAAIKFADLTESGSESGD
NEAEEPVSAGPDNANAIGEPGTSASAAEENGTVERNSPPPNCAICLSRCRRKCFTDSCMH
QFCFKCLCEWSKIKPECPLCKQPFRTIIHNVRTLDDYDRYPVQTTSPVPTENPSLRYHIV
RRPRYTPLVQNQAVIVNDIEAAIAAGAAGEDVLSAAEVAAGRRSYSRFEPYRSELMNYYQ
HDQDASTSGSLSQLWRRYVYDRKLYALPVSDSVTGHFREWSARFYRNNPAQIHRLMPWIH
RDIMCLLRNAAHSVNTVMTLMSDLLPMTSLLGPTFRRRLSPYLGERTSHFIHELFNFARS
PYDINGYDHVVQYSARVAEEVEVDLLDMVETQSSNGDDLNLEVGDSDADAINAGFSPDWS
PPRVRPSTSVIVTNPGATHSFSVTMASDGSELPGISIRRTTNVGSQTVAINLSMRRPAAV
ASEEPEVIEIDDGDAAANAEVAAINDGSNTSRRHAGATLPVTAHIELESSSSSGDEDECV
FVLELKPPHMRTPEQVSLDSNSDSDVVFVNEQHEAAPDAIAENRSTQSPLDLASRDQGLF
MGPSTSGAAANRGKNWKLVMAQTRRLDQLRTLRSIRSKKSRRSSMPARSDSGSSPSSCSS
SSFHFSSSSDEDSSDSSTTNSEPPKKKSRKRVANNKRSKKESIGKRTSRKRKAKDQNMEM
LEQQQISQKKPQRQPESSSDSPSSSDDESGGDSSESSGQPNTNNNKSSSDSDDDSAVNMQ
LSALRATLKAEATLEDRKPVKLELQLPDDDQAGPLHSRMTPSPREDNEPGCSAPKRRRSC
SHSNQSSQSASLASSSTATSSSAPLSSFAWGAAGFSGDPLMRGHPAMEEHDIANSLIELS
TLTQPVNIGLFNEHYNSAENSMGMLSNTLCDSPQTLAADDANLENYFDTDADPEASRERD
AYSLEAAIDVVGESELQIAEDTATATEEQDEEDEEDEDQEEDDQEEEKAAEEEEEEEEDD
DDSDNHDENDENQGLLPY
Download sequence
Identical sequences A0A0B4KEZ9 Q9V8P9
FBpp0085754 7227.FBpp0085754 NP_001261083.1.81976 NP_611388.1.81976 FBpp0085754 FBpp0304302 FBpp0085754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]